SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g17347

Feature Type:gene_model
Chromosome:Gm14
Start:19174426
stop:19175881
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g17347
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G46910AT Annotation by Michelle Graham. TAIR10: Plastid-lipid associated protein PAP / fibrillin family protein | chr2:19272427-19273856 FORWARD LENGTH=284 SoyBaseE_val: 2.00E-63ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
PF04755PFAM PAP fibrillin JGI ISS
UniRef100_B9RMZ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Structural molecule, putative n=1 Tax=Ricinus communis RepID=B9RMZ6_RICCO SoyBaseE_val: 1.00E-68ISS
UniRef100_UPI000233C112UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233C112 related cluster n=1 Tax=unknown RepID=UPI000233C112 SoyBaseE_val: 3.00E-124ISS

Expression Patterns of Glyma14g17347
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g17347 not represented in the dataset
Glyma14g17347 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g17347 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g134000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g17347
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g17347
>Glyma14g17347.1   sequence type=CDS   gene model=Glyma14g17347   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATCAGGATTGAGTTGGAGGAGCTTGTCCTTGGTGCCTTGTGCATTGAAGGCATATTATGATTATGAATTGGAGAATAAAAAGCATCTACTTCTGACCTCTATCCAAGACACGCAAAGGGGCCTCTTAACAACTACTAATCAATGCTCTTGTATCGAGGAGGCTCTGGTGAGTCTCGAAGGATGCAACATTGGCTGTCACCCTATCAATCTCTCCAACTTGGATGGAACATGGCGCCTCCAGTACACTTCTTCCTCTGATGTTCTCATTCTTCTCCAAGCTGTTGCTACTTTTCCTTTCTTTCAAGTTGGACAGATCTTTCAAAAATTTGAATGTTGTCATCAATCTAATGGAGGTGTTATCCGCTATGTTGTTCGATGGAGCATTCCAAATTTGTTAGAGGAACAAGAAGGTGCTACATTGCTTGTATCCGCCAAGTTTAATGTAGTATTTGTCTATAATATCTACCTTCAATTTCAAGAGATCACAATCCAAGATATAAATATTAGTGAAGAGCTGTAG
Predicted protein sequences of Glyma14g17347
>Glyma14g17347.1   sequence type=predicted peptide   gene model=Glyma14g17347   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKSGLSWRSLSLVPCALKAYYDYELENKKHLLLTSIQDTQRGLLTTTNQCSCIEEALVSLEGCNIGCHPINLSNLDGTWRLQYTSSSDVLILLQAVATFPFFQVGQIFQKFECCHQSNGGVIRYVVRWSIPNLLEEQEGATLLVSAKFNVVFVYNIYLQFQEITIQDINISEEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo