Glyma14g17280 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g17280

Feature Type:	gene_model
Chromosome:	Gm14
Start:	18997091
stop:	18998278
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g17280

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G36760	AT	Annotation by Michelle Graham. TAIR10: aminopeptidase P1 \| chr4:17326688-17329979 FORWARD LENGTH=645	SoyBase	E_val: 2.00E-31	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0006891	GO-bp	Annotation by Michelle Graham. GO Biological Process: intra-Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0009926	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin polar transport	SoyBase	N/A	ISS
GO:0009987	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular process	SoyBase	N/A	ISS
GO:0010351	GO-bp	Annotation by Michelle Graham. GO Biological Process: lithium ion transport	SoyBase	N/A	ISS
GO:0016558	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004177	GO-mf	Annotation by Michelle Graham. GO Molecular Function: aminopeptidase activity	SoyBase	N/A	ISS
GO:0010013	GO-mf	Annotation by Michelle Graham. GO Molecular Function: N-1-naphthylphthalamic acid binding	SoyBase	N/A	ISS
GO:0016787	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity	SoyBase	N/A	ISS
PTHR10804	Panther	PROTEASE FAMILY M24 (METHIONYL AMINOPEPTIDASE, AMINOPEPTIDASE P)	JGI		ISS
PTHR10804:SF6	Panther	gb def: possible cell cycle protein [leishmania major]	JGI		ISS
UniRef100_B9HEP1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HEP1_POPTR	SoyBase	E_val: 1.00E-34	ISS
UniRef100_G3E7N0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Xaa-Pro aminopeptidase 2 n=1 Tax=Glycine max RepID=G3E7N0_SOYBN	SoyBase	E_val: 1.00E-34	ISS

Expression Patterns of Glyma14g17280

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g17280 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g17280

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g17280

Limit To All Plant Sequences

>Glyma14g17280.1   sequence type=CDS   gene model=Glyma14g17280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGTTCACGACAAAGCTAGAGAGATCGGCATTGTGTGTTCAATTAAGTAGCCTCTTCCAAGGAAAGATCTCGAGCAACATGCGTGTGAAGCTCATAATAATGCATGTTAGCTCCTGCCTTATACTTGTATATGTTCTTGGACCTCACTTAATCAGTTTCAGACCACATGCTCAAAATGTACCATTGCAATCTTCCATGACTGTTACCAATGAACCTGGTTACTATGAGGATGGAGAGTTTGGGATAATATTGGAGAATGTGCTTATTGTTAAGGAGGCTGATACAAATTTCAATTTTGGTGATAGAGGTTACTTATCTTTTGAATACATTACCTGGTTTATTTTTTATATATATAAAATTCAGGTGGTAGTTGGTGGAGGTGCTGCTGAGGCAACATTATCAGTTAACTTGGAGTTCCTTGCTACAACTTTAGGATCTCAAGAGCGGTTGGCTATAGCAAAATTTGTTGAGTCATGTTAA

Predicted protein sequences of Glyma14g17280

Limit To All Plant Sequences

>Glyma14g17280.1   sequence type=predicted peptide   gene model=Glyma14g17280   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KFTTKLERSALCVQLSSLFQGKISSNMRVKLIIMHVSSCLILVYVLGPHLISFRPHAQNVPLQSSMTVTNEPGYYEDGEFGIILENVLIVKEADTNFNFGDRGYLSFEYITWFIFYIYKIQVVVGGGAAEATLSVNLEFLATTLGSQERLAIAKFVESC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain