Report for Sequence Feature Glyma14g17260
Feature Type: gene_model
Chromosome: Gm14
Start: 18970804
stop: 18971661
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma14g17260
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G24860 AT
Annotation by Michelle Graham. TAIR10: flowering promoting factor 1 | chr5:8541822-8542154 FORWARD LENGTH=110
SoyBase E_val: 3.00E-51 ISS
GO:0009739 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus
SoyBase N/A ISS
GO:0009911 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development
SoyBase N/A ISS
GO:0010228 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1M9R4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M9R4_SOYBN
SoyBase E_val: 1.00E-76 ISS
UniRef100_O23624 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Flowering-promoting factor 1 n=1 Tax=Arabidopsis thaliana RepID=FPF1_ARATH
SoyBase E_val: 1.00E-48 ISS
Expression Patterns of Glyma14g17260
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma14g17260
Paralog Evidence Comments
Glyma17g29720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma14g17260 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma14g17260
Coding sequences of Glyma14g17260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g17260.1 sequence type=CDS gene model=Glyma14g17260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCCGGGGTGTGGGTATTCAAGAATGGTGTGTTTCGTTTGGTGGAAAACCCTCAAGCTGAGGTCTCAGATAGGCATGGCAAGGGAAGTAGCTCAAAGAGAAAGATGTTGGTTCACTTGCCAACCGGGGAAGTGGTTTCTTCCTATGCTTTTCTTGAGCAGATCTTAACTGGATTAGGGTGGGAGAGGTACTATGATGGAGACCCTGACCTCTACCAATTCCACAAGCACTCTTCAATTGACCTAATTTCCCTCCCAAAAGATTTCTCCAAGTTCAACTCCATCAATATGTATGATATAGTCATCAAGAACCCCAATGTCTTCCATGTCCGGGATAAGTGA
Predicted protein sequences of Glyma14g17260
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g17260.1 sequence type=predicted peptide gene model=Glyma14g17260 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSGVWVFKNGVFRLVENPQAEVSDRHGKGSSSKRKMLVHLPTGEVVSSYAFLEQILTGLGWERYYDGDPDLYQFHKHSSIDLISLPKDFSKFNSINMYDIVIKNPNVFHVRDK*