Glyma14g17190 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g17190

Feature Type:	gene_model
Chromosome:	Gm14
Start:	18818043
stop:	18820541
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g17190

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G31360	AT	Annotation by Michelle Graham. TAIR10: selenium binding \| chr4:15221945-15223310 FORWARD LENGTH=186	SoyBase	E_val: 1.00E-36	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008430	GO-mf	Annotation by Michelle Graham. GO Molecular Function: selenium binding	SoyBase	N/A	ISS
UniRef100_I1M9R2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M9R2_SOYBN	SoyBase	E_val: 1.00E-128	ISS
UniRef100_Q9ZQ24	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Arabidopsis thaliana RepID=Q9ZQ24_ARATH	SoyBase	E_val: 1.00E-31	ISS

Expression Patterns of Glyma14g17190

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g17190

Paralog	Evidence	Comments
Glyma17g29690	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g17190 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g133100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g17190

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g17190

Limit To All Plant Sequences

>Glyma14g17190.1   sequence type=CDS   gene model=Glyma14g17190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGCCGGCGAAGCGCAAAGCGGAGGGAACTGCTGCAGCTGCCGCTTCTTCTGCGGCGGCTCCGATGAGAGTCACTCGTGCTGCGGCGAAGCGCGCCGCCGCGAGCTCCGACCCTCCGCCGGTGCCGGTGGTTAAGAAGGCGGCGAAGAAGGCCAAAGTTGCTGCTGCTGCTAAGAAGCAGAAAAGGAACGAAAAGGAAAATGAAGATGTTCCGGTTGAGAGCGAGAACAAAGCGGAAGAAAAAGAAGAAGGAGGAGACGCCTCCGAGAAGAACGTTCTAGACGCTTCCAACAAGACCATCGTCGTCGAACACTGCAAGCAATGTAACTCCTTCAAGACCAGGGCCAATCTGGTGAAGGTCGGCCTTGAGAAGGCCGACATTGGAATCACTGTGATTTTAAACCCTGAGAAGCCAAGGAAAGGATGCTTTGAAATACGGCAAGAAGGGGGTGGCAAGAAGTTCATAACTCTCTTGGACTTGAAGCGTCCATTTAAACCAATGAAGGATTTGGACATGGACAAGGTCATCTCGGACATCATTGAGGAAATATCAAAGACTAGTTGA

Predicted protein sequences of Glyma14g17190

Limit To All Plant Sequences

>Glyma14g17190.1   sequence type=predicted peptide   gene model=Glyma14g17190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPAKRKAEGTAAAAASSAAAPMRVTRAAAKRAAASSDPPPVPVVKKAAKKAKVAAAAKKQKRNEKENEDVPVESENKAEEKEEGGDASEKNVLDASNKTIVVEHCKQCNSFKTRANLVKVGLEKADIGITVILNPEKPRKGCFEIRQEGGGKKFITLLDLKRPFKPMKDLDMDKVISDIIEEISKTS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain