Glyma14g17100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g17100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g17100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g17100

Feature Type:	gene_model
Chromosome:	Gm14
Start:	18662246
stop:	18662771
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g17100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G19940	AT	Annotation by Michelle Graham. TAIR10: Plastid-lipid associated protein PAP / fibrillin family protein \| chr5:6739693-6740661 FORWARD LENGTH=239	SoyBase	E_val: 4.00E-12	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0019344	GO-bp	Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0019761	GO-bp	Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0005198	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural molecule activity	SoyBase	N/A	ISS
PF04755	PFAM	PAP fibrillin	JGI		ISS
UniRef100_C6T7P4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T7P4_SOYBN	SoyBase	E_val: 3.00E-14	ISS
UniRef100_H6U812	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: PAP fibrillin n=1 Tax=Wolffia australiana RepID=H6U812_9ARAE	SoyBase	E_val: 4.00E-11	ISS

Expression Patterns of Glyma14g17100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g17100 not represented in the dataset	Glyma14g17100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g17100

Paralog	Evidence	Comments
Glyma17g29660	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g17100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g17100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g17100

Limit To All Plant Sequences

>Glyma14g17100.1   sequence type=CDS   gene model=Glyma14g17100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGCGTCTCTCTTCCTTCCCTCTTCTCCGTTCAAACTCAACCCTCCAACGCCCAACTCTGTTACCGTTACGCTCCGTTTCCCTCCCCTCAATCGCCCCCCAACGTGCGAACCGGTCCTGATGAATGTCGATCTTGTTGCTTCCATTCTCTCTAAGTTTTCGTTTATTGTTAAACTTCTTTCTGATTTGATGCATGCTAATGTGAGACAGGAAAACTCAAGGCTCTGGATAGCACTGTATGGTGGCCAGAGTGAAGTTAAACTCAGAATCACTTATGTTGATGAGAAATTCAGGTTAGGATTGGGTTCCAGAGGTTCCCTGTTTGTTTTTCAAAGAATATGA

Predicted protein sequences of Glyma14g17100

Limit To All Plant Sequences

>Glyma14g17100.1   sequence type=predicted peptide   gene model=Glyma14g17100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAASLFLPSSPFKLNPPTPNSVTVTLRFPPLNRPPTCEPVLMNVDLVASILSKFSFIVKLLSDLMHANVRQENSRLWIALYGGQSEVKLRITYVDEKFRLGLGSRGSLFVFQRI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain