|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G02050 | AT | Annotation by Michelle Graham. TAIR10: NADH-ubiquinone oxidoreductase B18 subunit, putative | chr2:490024-490335 FORWARD LENGTH=103 | SoyBase | E_val: 1.00E-18 | ISS |
GO:0006007 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glucose catabolic process | SoyBase | N/A | ISS |
GO:0006120 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondrial electron transport, NADH to ubiquinone | SoyBase | N/A | ISS |
GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
GO:0009853 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photorespiration | SoyBase | N/A | ISS |
GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
GO:0080129 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005747 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0031966 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane | SoyBase | N/A | ISS |
GO:0045271 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I | SoyBase | N/A | ISS |
GO:0003954 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity | SoyBase | N/A | ISS |
GO:0008137 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity | SoyBase | N/A | ISS |
KOG3468 | KOG | NADH:ubiquinone oxidoreductase, NDUFB7/B18 subunit | JGI | ISS | |
PF05676 | PFAM | NADH-ubiquinone oxidoreductase B18 subunit (NDUFB7) | JGI | ISS | |
UniRef100_C6SZG1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SZG1_SOYBN | SoyBase | E_val: 1.00E-26 | ISS |
UniRef100_E5F708 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NADH-ubiquinone oxidoreductase B18 n=1 Tax=Eutrema parvulum RepID=E5F708_9BRAS | SoyBase | E_val: 1.00E-17 | ISS |
Glyma14g17025 not represented in the dataset |
Glyma14g17025 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.14g132200 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g17025.1 sequence type=CDS gene model=Glyma14g17025 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAGTGGAAGGGTCATCGGAGAAGATGATAGTGACACAGCAGGAGGAGATGGTGGAGGCCAGGCCCGAGTTCTACCTCCCTTGGAAGTGCGAGAATGAGTGCCACTCCTACGAAAAGTGCGAGTACGAGCTCGTCATGGAGAAAATGCTCCAGATGCAAAAGATCCACCAACACCAACAAAAATCCAACCCCAAACAACTCCTTATCCCACTTCCCAAACTTGCCAATGCCTGA
>Glyma14g17025.1 sequence type=predicted peptide gene model=Glyma14g17025 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKVEGSSEKMIVTQQEEMVEARPEFYLPWKCENECHSYEKCEYELVMEKMLQMQKIHQHQQKSNPKQLLIPLPKLANA*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||