| 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| ATCG00040 | AT | Annotation by Michelle Graham. TAIR10: maturase K | chrC:2056-3636 REVERSE LENGTH=526 | SoyBase | E_val: 8.00E-39 | ISS | 
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS | 
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS | 
| GO:0006397 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mRNA processing | SoyBase | N/A | ISS | 
| GO:0008380 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA splicing | SoyBase | N/A | ISS | 
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS | 
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS | 
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS | 
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS | 
| GO:0003964 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA-directed DNA polymerase activity | SoyBase | N/A | ISS | 
| PF01348 | PFAM | Type II intron maturase | JGI | ISS | |
| PF01824 | PFAM | MatK/TrnK amino terminal region | JGI | ISS | |
| UniRef100_H8PI40 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Maturase K n=1 Tax=Glycine soja RepID=H8PI40_GLYSO | SoyBase | E_val: 7.00E-77 | ISS | 
| UniRef100_H8PI40 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Maturase K n=1 Tax=Glycine soja RepID=H8PI40_GLYSO | SoyBase | E_val: 7.00E-77 | ISS | 
| 
			 Glyma14g17011 not represented in the dataset  | 
			 Glyma14g17011 not represented in the dataset  | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection  | 
			Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome  | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.14g132100 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183  | 
    
>Glyma14g17011.1 sequence type=CDS gene model=Glyma14g17011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCAGATGTTCTATGAAAAAATAGAACATCTTGTAGAAGTATCTGTTAAGGATTGTTCATATACCTTATCATTCTTTAAGGATAATTTCATGCATTATGTTAGATATCAAGGAAAATTCATTTTGGTTTCAAAGAATACTCCTCTTTTGATAAATAAATGGAAATACAATTTTATCTATTTATGGCAATGTCATTTTGATATTTGTATTCGGCCTAATCTTTCAGTGGTACAAAATCATATGTTGCAAAATTCATTTCTAATAAAAATGGTTATGAAAAGGCTGGATACAATAGTTCCAATTATTCCTCTAATTAGATCATTGGCGAAAGCAAAATTTTGTAATGTATTTGGCCATCCCATTTGTAAGCCGAGTTTGTATCAAATAAGATATATACTTCGACTTTCTTGTATAAAAACTTTGACTCGTAAGCACAAA
>Glyma14g17011.1 sequence type=predicted peptide gene model=Glyma14g17011 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MQMFYEKIEHLVEVSVKDCSYTLSFFKDNFMHYVRYQGKFILVSKNTPLLINKWKYNFIYLWQCHFDICIRPNLSVVQNHMLQNSFLIKMVMKRLDTIVPIIPLIRSLAKAKFCNVFGHPICKPSLYQIRYILRLSCIKTLTRKHK
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||