Glyma14g17011 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g17011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g17011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g17011

Feature Type:	gene_model
Chromosome:	Gm14
Start:	18496936
stop:	18498888
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g17011

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00040	AT	Annotation by Michelle Graham. TAIR10: maturase K \| chrC:2056-3636 REVERSE LENGTH=526	SoyBase	E_val: 8.00E-39	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006397	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA processing	SoyBase	N/A	ISS
GO:0008380	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA splicing	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003964	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA-directed DNA polymerase activity	SoyBase	N/A	ISS
PF01348	PFAM	Type II intron maturase	JGI		ISS
PF01824	PFAM	MatK/TrnK amino terminal region	JGI		ISS
UniRef100_H8PI40	UniRef	Annotation by Michelle Graham. Best UniRef hit: Maturase K n=1 Tax=Glycine soja RepID=H8PI40_GLYSO	SoyBase	E_val: 7.00E-77	ISS
UniRef100_H8PI40	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Maturase K n=1 Tax=Glycine soja RepID=H8PI40_GLYSO	SoyBase	E_val: 7.00E-77	ISS

Expression Patterns of Glyma14g17011

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g17011 not represented in the dataset	Glyma14g17011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g17011 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g132100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g17011

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g17011

Limit To All Plant Sequences

>Glyma14g17011.1   sequence type=CDS   gene model=Glyma14g17011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGATGTTCTATGAAAAAATAGAACATCTTGTAGAAGTATCTGTTAAGGATTGTTCATATACCTTATCATTCTTTAAGGATAATTTCATGCATTATGTTAGATATCAAGGAAAATTCATTTTGGTTTCAAAGAATACTCCTCTTTTGATAAATAAATGGAAATACAATTTTATCTATTTATGGCAATGTCATTTTGATATTTGTATTCGGCCTAATCTTTCAGTGGTACAAAATCATATGTTGCAAAATTCATTTCTAATAAAAATGGTTATGAAAAGGCTGGATACAATAGTTCCAATTATTCCTCTAATTAGATCATTGGCGAAAGCAAAATTTTGTAATGTATTTGGCCATCCCATTTGTAAGCCGAGTTTGTATCAAATAAGATATATACTTCGACTTTCTTGTATAAAAACTTTGACTCGTAAGCACAAA

Predicted protein sequences of Glyma14g17011

Limit To All Plant Sequences

>Glyma14g17011.1   sequence type=predicted peptide   gene model=Glyma14g17011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQMFYEKIEHLVEVSVKDCSYTLSFFKDNFMHYVRYQGKFILVSKNTPLLINKWKYNFIYLWQCHFDICIRPNLSVVQNHMLQNSFLIKMVMKRLDTIVPIIPLIRSLAKAKFCNVFGHPICKPSLYQIRYILRLSCIKTLTRKHK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain