Glyma14g16850 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g16850

Feature Type:	gene_model
Chromosome:	Gm14
Start:	18344055
stop:	18345247
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g16850

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13070	AT	Annotation by Michelle Graham. TAIR10: CBS domain-containing protein / transporter associated domain-containing protein \| chr3:4191511-4195112 REVERSE LENGTH=661	SoyBase	E_val: 4.00E-61	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR22777	Panther	HEMOLYSIN-RELATED	JGI		ISS
PF01595	PFAM	Domain of unknown function DUF21	JGI		ISS
UniRef100_B9T467	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Magnesium and cobalt efflux protein corC, putative n=1 Tax=Ricinus communis RepID=B9T467_RICCO	SoyBase	E_val: 2.00E-59	ISS
UniRef100_I1M6I6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M6I6_SOYBN	SoyBase	E_val: 2.00E-63	ISS

Expression Patterns of Glyma14g16850

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g16850 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g16850

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g16850

Limit To All Plant Sequences

>Glyma14g16850.1   sequence type=CDS   gene model=Glyma14g16850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGTAAGGTTCGTGAGTTGGCCGAAAAGGAGCCTGAAAATGGTGTCTTCAGACTACTCCGAAGTGATGTTACTCGGTTCCTTACAACAATACTTATTGGCACAACAGTGGTCAATATTGGGGCAACTGCTTTGGTCACTGAAGCAGCAACTGCTATGTTTGGTGAAGCTGGTATCAGTGCAGCAATAGGAGCGATGACTGTTGCCATTTTGCTTCTCACTGAAATCACTCCAAAAAGCATAGCTGTTCATAATGCCACAAAAGTGTCTCGGTTTGTGGTCAGACCAGTGGCATGGCTTTCCTTGGTGTTGTATCCTGTAGGAAGAATTGTTACTTATCTTTGTAAAATTAAATGCTACTCACACTTTAATGCA

Predicted protein sequences of Glyma14g16850

Limit To All Plant Sequences

>Glyma14g16850.1   sequence type=predicted peptide   gene model=Glyma14g16850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MCKVRELAEKEPENGVFRLLRSDVTRFLTTILIGTTVVNIGATALVTEAATAMFGEAGISAAIGAMTVAILLLTEITPKSIAVHNATKVSRFVVRPVAWLSLVLYPVGRIVTYLCKIKCYSHFNA

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain