SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g16791): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g16791): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g16791

Feature Type:gene_model
Chromosome:Gm14
Start:18264427
stop:18272088
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G31160AT Annotation by Michelle Graham. TAIR10: DDB1-CUL4 associated factor 1 | chr4:15145936-15152939 FORWARD LENGTH=1883 SoyBaseE_val: 5.00E-158ISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0048827GO-bp Annotation by Michelle Graham. GO Biological Process: phyllome development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR13129Panther VPRBP PROTEIN-RELATED JGI ISS
PTHR13129:SF4Panther gb def: ebip9171 [anopheles gambiae str. pest] JGI ISS
UniRef100_G7JCB0UniRef Annotation by Michelle Graham. Best UniRef hit: DDB1-and CUL4-associated factor-like protein n=1 Tax=Medicago truncatula RepID=G7JCB0_MEDTR SoyBaseE_val: 0ISS
UniRef100_G7JCB0UniRef Annotation by Michelle Graham. Most informative UniRef hit: DDB1-and CUL4-associated factor-like protein n=1 Tax=Medicago truncatula RepID=G7JCB0_MEDTR SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g16791 not represented in the dataset

Glyma14g16791 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g131100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g16791.1   sequence type=CDS   gene model=Glyma14g16791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGACGAACGTAGATTGGGATGGTTCATCCCTTAGGGCGCTGAGCAAGTGCATACGCTCCCTCCAAATTGAACTCGAAGACCCAATTTTCCAAGCCAACCCCACCGTCTCAAACCTAATCGACCAACTCCACGACCTTCTTCAACCTCTCTCTTCCGCCCTAATTCACCAACATCCTTTTCGTGATCCTGCTTCTTCTCTGCCTCGCCATCACGAAAAGAAGATTGATGGAGCTATTCCTACCTTAAGGCAGATTGAAATAGAAGCTATAGCTGCTGCCACCCCTATAACGTACCTTCCAAGGGACCTTTTGCTCCTAATTCATGAACACCTACTGGCATCTGGATTGTTACAAACTGCTTCAATGTTGCTTAAAGAGGCTCAGTTGAAACCTTTGCCAACATTGGTTGCCCCATCTTCTCTTGTGCAACAACCCTACTCACAGGAAGCTCCTCCAATACAACTTCAGTGGCCTTCTGCTCCAGTTCCAGGATTTCTGTCTAAGAAATTAAATCTTAATGCAGAGGATAAGGATGTTGAATCTCAGTATGAGACTCCAATAATCTTGCCAATGAAACATAAGTTATCTGATTTAAAGGATATAGGAGTGTCGTCATCATCTGGAAAGCGATTGAATGTTGGGGATCTAGGATTTCATTCTCCTATTTGTCCAACTCCAAGTGTGATACGTAAAAGTAGCCTGCAGACTGATGCCACTGTGCTTTATACACCAAGTTCCAATCTGAGAAATCAACAAGGGCCCTGTACAGCTGATTATGTGGATGAGAGTCAAAGAAGTATGCCAAATCTAGGTCAGATTACACCATCCTCTCTGGTAATTAATGATCATCTGCCCAATTACCCAGAACGTATAACATTAGATTCTCTAGTGGTTCAGTATCTGCAGCATCAGCATTGCCAGTGCCCAACTCCTATTATCACTCTTCCATCACTTTCTCTTTTGCACCCTCATGTTTGTGCTGAACCCAAGCAAAGTCTTGATGCCCCTTCTAATGTGACATCTCGTCTTGGTACACGTGAATTTAAATTTATGTATCATGTACATGGAAATCGCAGGGATCGTAAATTTGTTTATAGCCAATTCAGACCATCGGGCACTGCTGCTGATGTTTACTCGTTAACAGGCATTACGTTTCTTGGGGACTCTCCTTTTATTGCTGTTGGAAACAACAGTGGAGACATCCAATTTTGGGATACTACTTCATTGAAGCACCATGACGACACCTATCATTATGAAGAATGTCACAGAGATCCCTTGACACTTATTCAGTCTTTTATTTCTGCTGACTGCCAGCTGTTGCTTTCTTCAAGTTCCGAAGATGTAAAGTTGTGGAATGTTTCATCATTTTTAAATGACAATGTTTGGGACGAATACGAAAATGTAATCCATTTTTTTCATGGATGCAAGGCTGCCAGGTTTAGCCACTCAGGGAATGTTTTTGCAGCCTTGTCATCGGAATCTGCACCACAGGAAATCAAGTTATATGATATCGAAACATGTGAGCTAGAGTCTATGTTGTTATATACTTCTACAAATTTTGCCAGTAGGGGTCATCTTTATTCTCCAATCCATTTTAGCCATTCTGACTCAATGCTGCTTTGGAATGGTGTCTTGTGGGACCGTAGGGTTTCTGGGCCTGTTCATCATTTTGATCAGTTGACAGACTTTGGGGGTGGAGGCTTTCATCCTGCTGGCAATGAGGTTATTATAAACTCTGAAGTGTGGGATCTGCGCAAGTTCAGACTTCTTCGTAGTGTACCTTCATTAGATCAAACAACAATAACATTTAATGCTCATGGAGATGTAATATATGCTATTCTAAGGAGAAATATTGAGGATGTAATGTCAGCATTTCACACACGCCGGGTCAAGCATCCGCTTTTTGCAGCTTTCCGCACTGTGGATGCAGTGAATTATTCTGATATTGCTACTACCCCAGTGGAACATTGTGTGCTTGATTTTACTACTGAGCCAACAGATTCATTTGTAGGGTTGGTTACTATAGCAAAACATGATTGGTATATTGAATATGAAGATTCAGATTCAGATGAAAGTCTTCTTCCAGAGACGTGGGGCTGTGTCAAAATCTATGAAATTGGTCATCGAAGTCCAACCAATGACGATTGA

>Glyma14g16791.1   sequence type=predicted peptide   gene model=Glyma14g16791   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATNVDWDGSSLRALSKCIRSLQIELEDPIFQANPTVSNLIDQLHDLLQPLSSALIHQHPFRDPASSLPRHHEKKIDGAIPTLRQIEIEAIAAATPITYLPRDLLLLIHEHLLASGLLQTASMLLKEAQLKPLPTLVAPSSLVQQPYSQEAPPIQLQWPSAPVPGFLSKKLNLNAEDKDVESQYETPIILPMKHKLSDLKDIGVSSSSGKRLNVGDLGFHSPICPTPSVIRKSSLQTDATVLYTPSSNLRNQQGPCTADYVDESQRSMPNLGQITPSSLVINDHLPNYPERITLDSLVVQYLQHQHCQCPTPIITLPSLSLLHPHVCAEPKQSLDAPSNVTSRLGTREFKFMYHVHGNRRDRKFVYSQFRPSGTAADVYSLTGITFLGDSPFIAVGNNSGDIQFWDTTSLKHHDDTYHYEECHRDPLTLIQSFISADCQLLLSSSSEDVKLWNVSSFLNDNVWDEYENVIHFFHGCKAARFSHSGNVFAALSSESAPQEIKLYDIETCELESMLLYTSTNFASRGHLYSPIHFSHSDSMLLWNGVLWDRRVSGPVHHFDQLTDFGGGGFHPAGNEVIINSEVWDLRKFRLLRSVPSLDQTTITFNAHGDVIYAILRRNIEDVMSAFHTRRVKHPLFAAFRTVDAVNYSDIATTPVEHCVLDFTTEPTDSFVGLVTIAKHDWYIEYEDSDSDESLLPETWGCVKIYEIGHRSPTNDD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo