|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G20050 | AT | Annotation by Michelle Graham. TAIR10: T-complex protein 1 alpha subunit | chr3:6998544-7002266 REVERSE LENGTH=545 | SoyBase | E_val: 2.00E-12 | ISS |
| GO:0000085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle | SoyBase | N/A | ISS |
| GO:0001510 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA methylation | SoyBase | N/A | ISS |
| GO:0006094 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gluconeogenesis | SoyBase | N/A | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0007010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0009220 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0010498 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process | SoyBase | N/A | ISS |
| GO:0034968 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone lysine methylation | SoyBase | N/A | ISS |
| GO:0044267 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
| UniRef100_I1KSL6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN | SoyBase | E_val: 4.00E-15 | ISS |
| UniRef100_I1KSL6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN | SoyBase | E_val: 4.00E-15 | ISS |
|
Glyma14g15250 not represented in the dataset |
Glyma14g15250 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g15250.1 sequence type=CDS gene model=Glyma14g15250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high GTTGAAAAGCTAGGAAAAGACTCACTAATTAACTGTGCCAAGACCAGTATGTCCTTAAAGTTGATAGCTGGTGATAATGACTTCTTTGCCATTTTGTTATATGCAGTGCAAGCTGTAAAGATGACCAATGCTCGAGCAATATGGGAATGCCTCTTAGGGTTGCCCTTGCAAGAATTGCTTGTCTTGATTTCAATCTTCAAAAGACAAAAATCTAGAGAAAATTCATCAAATGAATTTTCGTATATATCCAAAAATTTCAATATTGGAATCGATAATTCACATAGTAGGACTTATTTGATCTTTTAA
>Glyma14g15250.1 sequence type=predicted peptide gene model=Glyma14g15250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high VEKLGKDSLINCAKTSMSLKLIAGDNDFFAILLYAVQAVKMTNARAIWECLLGLPLQELLVLISIFKRQKSRENSSNEFSYISKNFNIGIDNSHSRTYLIF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||