SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g15250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g15250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g15250

Feature Type:gene_model
Chromosome:Gm14
Start:16134293
stop:16135337
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20050AT Annotation by Michelle Graham. TAIR10: T-complex protein 1 alpha subunit | chr3:6998544-7002266 REVERSE LENGTH=545 SoyBaseE_val: 2.00E-12ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0044267GO-bp Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
UniRef100_I1KSL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN SoyBaseE_val: 4.00E-15ISS
UniRef100_I1KSL6UniRef Annotation by Michelle Graham. Best UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN SoyBaseE_val: 4.00E-15ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g15250 not represented in the dataset

Glyma14g15250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g15250.1   sequence type=CDS   gene model=Glyma14g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGAAAAGCTAGGAAAAGACTCACTAATTAACTGTGCCAAGACCAGTATGTCCTTAAAGTTGATAGCTGGTGATAATGACTTCTTTGCCATTTTGTTATATGCAGTGCAAGCTGTAAAGATGACCAATGCTCGAGCAATATGGGAATGCCTCTTAGGGTTGCCCTTGCAAGAATTGCTTGTCTTGATTTCAATCTTCAAAAGACAAAAATCTAGAGAAAATTCATCAAATGAATTTTCGTATATATCCAAAAATTTCAATATTGGAATCGATAATTCACATAGTAGGACTTATTTGATCTTTTAA

>Glyma14g15250.1   sequence type=predicted peptide   gene model=Glyma14g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VEKLGKDSLINCAKTSMSLKLIAGDNDFFAILLYAVQAVKMTNARAIWECLLGLPLQELLVLISIFKRQKSRENSSNEFSYISKNFNIGIDNSHSRTYLIF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo