SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g15250

Feature Type:gene_model
Chromosome:Gm14
Start:16134293
stop:16135337
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G20050AT Annotation by Michelle Graham. TAIR10: T-complex protein 1 alpha subunit | chr3:6998544-7002266 REVERSE LENGTH=545 SoyBaseE_val: 2.00E-12ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0034968GO-bp Annotation by Michelle Graham. GO Biological Process: histone lysine methylation SoyBaseN/AISS
GO:0044267GO-bp Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
UniRef100_I1KSL6UniRef Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN SoyBaseE_val: 4.00E-15ISS
UniRef100_I1KSL6UniRef Annotation by Michelle Graham. Best UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN SoyBaseE_val: 4.00E-15ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g15250.1   sequence type=CDS   gene model=Glyma14g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGAAAAGCTAGGAAAAGACTCACTAATTAACTGTGCCAAGACCAGTATGTCCTTAAAGTTGATAGCTGGTGATAATGACTTCTTTGCCATTTTGTTATATGCAGTGCAAGCTGTAAAGATGACCAATGCTCGAGCAATATGGGAATGCCTCTTAGGGTTGCCCTTGCAAGAATTGCTTGTCTTGATTTCAATCTTCAAAAGACAAAAATCTAGAGAAAATTCATCAAATGAATTTTCGTATATATCCAAAAATTTCAATATTGGAATCGATAATTCACATAGTAGGACTTATTTGATCTTTTAA

>Glyma14g15250.1   sequence type=predicted peptide   gene model=Glyma14g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VEKLGKDSLINCAKTSMSLKLIAGDNDFFAILLYAVQAVKMTNARAIWECLLGLPLQELLVLISIFKRQKSRENSSNEFSYISKNFNIGIDNSHSRTYLIF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo