Glyma14g15250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g15250

Feature Type:	gene_model
Chromosome:	Gm14
Start:	16134293
stop:	16135337
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g15250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G20050	AT	Annotation by Michelle Graham. TAIR10: T-complex protein 1 alpha subunit \| chr3:6998544-7002266 REVERSE LENGTH=545	SoyBase	E_val: 2.00E-12	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0034968	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone lysine methylation	SoyBase	N/A	ISS
GO:0044267	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular protein metabolic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0051082	GO-mf	Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding	SoyBase	N/A	ISS
UniRef100_I1KSL6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN	SoyBase	E_val: 4.00E-15	ISS
UniRef100_I1KSL6	UniRef	Annotation by Michelle Graham. Best UniRef hit: T-complex protein 1 subunit alpha n=1 Tax=Glycine max RepID=I1KSL6_SOYBN	SoyBase	E_val: 4.00E-15	ISS

Expression Patterns of Glyma14g15250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g15250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g15250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g15250

Limit To All Plant Sequences

>Glyma14g15250.1   sequence type=CDS   gene model=Glyma14g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTGAAAAGCTAGGAAAAGACTCACTAATTAACTGTGCCAAGACCAGTATGTCCTTAAAGTTGATAGCTGGTGATAATGACTTCTTTGCCATTTTGTTATATGCAGTGCAAGCTGTAAAGATGACCAATGCTCGAGCAATATGGGAATGCCTCTTAGGGTTGCCCTTGCAAGAATTGCTTGTCTTGATTTCAATCTTCAAAAGACAAAAATCTAGAGAAAATTCATCAAATGAATTTTCGTATATATCCAAAAATTTCAATATTGGAATCGATAATTCACATAGTAGGACTTATTTGATCTTTTAA

Predicted protein sequences of Glyma14g15250

Limit To All Plant Sequences

>Glyma14g15250.1   sequence type=predicted peptide   gene model=Glyma14g15250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VEKLGKDSLINCAKTSMSLKLIAGDNDFFAILLYAVQAVKMTNARAIWECLLGLPLQELLVLISIFKRQKSRENSSNEFSYISKNFNIGIDNSHSRTYLIF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain