SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g15230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g15230): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g15230

Feature Type:gene_model
Chromosome:Gm14
Start:16076992
stop:16078549
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g15230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G53870AT Annotation by Michelle Graham. TAIR10: Ribosomal protein S3 family protein | chr3:19951547-19952782 FORWARD LENGTH=249 SoyBaseE_val: 2.00E-51ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0015935GO-cc Annotation by Michelle Graham. GO Cellular Compartment: small ribosomal subunit SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0022627GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR11760Panther 30S RIBOSOMAL PROTEIN S3 JGI ISS
PTHR11760:SF9Panther 40S RIBOSOMAL PROTEIN S3 JGI ISS
PF00189PFAM Ribosomal protein S3, C-terminal domain JGI ISS
UniRef100_B7FH64UniRef Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S3 n=1 Tax=Medicago truncatula RepID=B7FH64_MEDTR SoyBaseE_val: 2.00E-53ISS
UniRef100_UPI00018C69B0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C69B0 related cluster n=1 Tax=unknown RepID=UPI00018C69B0 SoyBaseE_val: 5.00E-54ISS

Expression Patterns of Glyma14g15230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g15230 not represented in the dataset
Glyma14g15230 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g15230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g15230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g15230
>Glyma14g15230.1   sequence type=CDS   gene model=Glyma14g15230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTGCTATGGTGTTTTAGAATTTGTGATGGAAAGTGGGGCCAAAGGATGCGAGGTCATTACTAGTGGAAAACTGAGAGCTCTGAGAGCCAAGTCCATGAAATTCAAGGATGGATACATGATTTCTTTTGGACAACCAGTCAAGGATTATATTGACTCAGTAGTGAGACACGGTGCTCTTGGTATCAAGGTTAAGATCATGCTTGATTGGGATCCTAAAGGGAATCAGAGTCCTAAAACTCCCTTTCCTGATCTTGTCACGATCCACACTCCAAAGGAGGAAGAATACAAGTAG
Predicted protein sequences of Glyma14g15230
>Glyma14g15230.1   sequence type=predicted peptide   gene model=Glyma14g15230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACYGVLEFVMESGAKGCEVITSGKLRALRAKSMKFKDGYMISFGQPVKDYIDSVVRHGALGIKVKIMLDWDPKGNQSPKTPFPDLVTIHTPKEEEYK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo