SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g15080

Feature Type:gene_model
Chromosome:Gm14
Start:15782442
stop:15783794
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g15080
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G54770AT Annotation by Michelle Graham. TAIR10: Fcf2 pre-rRNA processing protein | chr1:20434803-20435815 FORWARD LENGTH=189 SoyBaseE_val: 5.00E-39ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR21686Panther UNCHARACTERIZED JGI ISS
PTHR21686:SF3Panther UNCHARACTERIZED JGI ISS
PF08698PFAM Fcf2 pre-rRNA processing JGI ISS
UniRef100_G7KBW9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Deoxynucleotidyltransferase terminal-interacting protein n=2 Tax=Medicago truncatula RepID=G7KBW9_MEDTR SoyBaseE_val: 5.00E-46ISS
UniRef100_UPI000233BE34UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BE34 related cluster n=1 Tax=unknown RepID=UPI000233BE34 SoyBaseE_val: 2.00E-76ISS

Expression Patterns of Glyma14g15080
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g15080 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g125900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g15080
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g15080
>Glyma14g15080.2   sequence type=CDS   gene model=Glyma14g15080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGCCCAAACCATCACCCCTGAGTTGCAGAAAGATTTGAAGTTATTAAAGTTGAGGGCTGCCCTCGATCCAAAGCGGCACTACAAGAAAGGTGATTCCAAATCGAAGACACTTCCCAAATATTTCCAGGTTGGGACAGTTGTAGATTCTCCGTTGGACTTTTTCTCAGGCAGATTAACAAAGAAGAAGAGGAAAGCAAGGCTTGCAGATGAGGTGCTTTCTGATCAAAACCTTGCAGCCTATAGAAAGCGGAAGGTTCGAGAAATTGAAGAACAAAATCGACCAGCTGGGAATGAAAAGTGGAAGATTAAGGGTAGTAATTCCCGTAGGCACAAATTATAA
Predicted protein sequences of Glyma14g15080
>Glyma14g15080.2   sequence type=predicted peptide   gene model=Glyma14g15080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPAQTITPELQKDLKLLKLRAALDPKRHYKKGDSKSKTLPKYFQVGTVVDSPLDFFSGRLTKKKRKARLADEVLSDQNLAAYRKRKVREIEEQNRPAGNEKWKIKGSNSRRHKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo