SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g15055

Feature Type:gene_model
Chromosome:Gm14
Start:15773102
stop:15773884
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g15055
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G15710AT Annotation by Michelle Graham. TAIR10: prephenate dehydrogenase family protein | chr1:5404505-5405581 FORWARD LENGTH=358 SoyBaseE_val: 1.00E-64ISS
GO:0006567GO-bp Annotation by Michelle Graham. GO Biological Process: threonine catabolic process SoyBaseN/AISS
GO:0006571GO-bp Annotation by Michelle Graham. GO Biological Process: tyrosine biosynthetic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004665GO-mf Annotation by Michelle Graham. GO Molecular Function: prephenate dehydrogenase (NADP+) activity SoyBaseN/AISS
GO:0008977GO-mf Annotation by Michelle Graham. GO Molecular Function: prephenate dehydrogenase activity SoyBaseN/AISS
PF02153PFAM Prephenate dehydrogenase JGI ISS
UniRef100_G7JGK2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Arogenate dehydrogenase n=1 Tax=Medicago truncatula RepID=G7JGK2_MEDTR SoyBaseE_val: 2.00E-71ISS
UniRef100_UPI000233A704UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A704 related cluster n=1 Tax=unknown RepID=UPI000233A704 SoyBaseE_val: 4.00E-114ISS

Expression Patterns of Glyma14g15055
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g15055 not represented in the dataset
Glyma14g15055 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g15055 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g15055
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g15055
>Glyma14g15055.1   sequence type=CDS   gene model=Glyma14g15055   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTTTCCACCTTTCAGGCGGCGCCACCGAAACCCTCATTGGGTTGCAGTCTTCTTAGCCGTCGTATGAAACGCATTCCCTTGTCCTTGTCAAATACCATCTCTTCTTACAAACCCGTCCTACGCATTCGCGCCATCGACGGCCACACCGTCCTGGCCCACTCCCGCTCCGACCACTCCCTCACGGCCCAACAACTCGGCGTCACCTTCTTCCCCAACCCCCACGACCTCTGCGAGGAACACCCCGAAGTGATTCTCTTATGCTCCTCCATCATCTGCACCCAGCGTGTGCTCCTCACTCTCCCCCTCCAGCGCTTAAAACGCAGCACACCCTTCGTCGACCTGCTTCCCGTCAAAGAGTTCCCCAAAAACCTCCTTCTCCACGCGCTCCCCTCCGATTTCGACGTTCTCTGCACCCACCCCATGTTCGGCCCACAGAGCGTCCCCTGCTCTTGGACCGGCCTCCCCTTCGTCTACGAGAAGGTCCGAATCAGCTCCGACGAGCACCGAATCGCACGCTGCGACAATTTCCTCCTCGGCATTTTCTCGAGGGAGGGGTGCAGGTTGGTGAAGATGAGCTGCGCCGACCACGATAAGTTCGCGGCCACGATAAGTTCCGGTGATGTTGTTAAACTCTACAACAATGACTCGTAA
Predicted protein sequences of Glyma14g15055
>Glyma14g15055.1   sequence type=predicted peptide   gene model=Glyma14g15055   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVSTFQAAPPKPSLGCSLLSRRMKRIPLSLSNTISSYKPVLRIRAIDGHTVLAHSRSDHSLTAQQLGVTFFPNPHDLCEEHPEVILLCSSIICTQRVLLTLPLQRLKRSTPFVDLLPVKEFPKNLLLHALPSDFDVLCTHPMFGPQSVPCSWTGLPFVYEKVRISSDEHRIARCDNFLLGIFSREGCRLVKMSCADHDKFAATISSGDVVKLYNNDS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo