SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g15040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g15040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g15040

Feature Type:gene_model
Chromosome:Gm14
Start:15760119
stop:15766046
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G30495AT Annotation by Michelle Graham. TAIR10: Fcf2 pre-rRNA processing protein | chr5:11380190-11381391 FORWARD LENGTH=196 SoyBaseE_val: 5.00E-70ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3100 KOG Uncharacterized conserved protein JGI ISS
PTHR21686Panther UNCHARACTERIZED JGI ISS
PTHR21686:SF3Panther UNCHARACTERIZED JGI ISS
PF08698PFAM Fcf2 pre-rRNA processing JGI ISS
UniRef100_G7KBW9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Deoxynucleotidyltransferase terminal-interacting protein n=2 Tax=Medicago truncatula RepID=G7KBW9_MEDTR SoyBaseE_val: 3.00E-88ISS
UniRef100_UPI000233BE31UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BE31 related cluster n=1 Tax=unknown RepID=UPI000233BE31 SoyBaseE_val: 1.00E-136ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g15040 not represented in the dataset

Glyma14g15040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g125600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g15040.2   sequence type=CDS   gene model=Glyma14g15040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAGAACGCAAACCAGTTGTTGGGTTATCATGGCAACCACAGTTGCCTATTCCATCATCATTAAAAGCCACTGATGGGTCTCATACCAAACCTCAAACTGAGGCATCAAGCAGCACTGTTAGGAAATCCAGTTCAGAGCTGGTTGATGGCCTTTTTGTCCCTCCAAATGATCCCAAAAAATTAAACAAGTTACTGAGAAAGCAAGCTAAAGATACTGCTGGGAAAAATTGGTTCAATATGCCAGCCCAAACCATCACCCCTGAGTTGACGAAAGATTTGAAGTTATTAAAGTTGAGGGCTGCCCTCGATCCAAAGCGGCACTACAAGAAAGGTGATTCCAAATCGAAGACACTTCCCAAATATTTCCAGGTTGGGACAGTTGTAGATTCTCCGTTGGACTTTTTCTCAGGCAGATTAACAAAGAAGAAGAGGAAAGCAAGGCTTGCAGATGAGCTGCTTTCTGATCAAAACCTTGCAGCCTATAGAAAGCGGAAGGTTCGAGAAATTGAAGAACAAAATCGACCAGCTGGGAATGAAAAGTGGAAGATTAAGGGTAGTAATTCCCGTAGGCACAAATTATAA

>Glyma14g15040.2   sequence type=predicted peptide   gene model=Glyma14g15040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPERKPVVGLSWQPQLPIPSSLKATDGSHTKPQTEASSSTVRKSSSELVDGLFVPPNDPKKLNKLLRKQAKDTAGKNWFNMPAQTITPELTKDLKLLKLRAALDPKRHYKKGDSKSKTLPKYFQVGTVVDSPLDFFSGRLTKKKRKARLADELLSDQNLAAYRKRKVREIEEQNRPAGNEKWKIKGSNSRRHKL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo