SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g15015

Feature Type:gene_model
Chromosome:Gm14
Start:15752887
stop:15753768
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g15015
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G18570AT Annotation by Michelle Graham. TAIR10: Oleosin family protein | chr3:6396072-6396572 REVERSE LENGTH=166 SoyBaseE_val: 1.00E-35ISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0012511GO-cc Annotation by Michelle Graham. GO Cellular Compartment: monolayer-surrounded lipid storage body SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01277PFAM Oleosin JGI ISS
UniRef100_G7JS16UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oleosin n=1 Tax=Medicago truncatula RepID=G7JS16_MEDTR SoyBaseE_val: 3.00E-54ISS
UniRef100_I1M9K5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1M9K5_SOYBN SoyBaseE_val: 1.00E-64ISS

Expression Patterns of Glyma14g15015
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g15015 not represented in the dataset
Glyma14g15015 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g15015 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g125500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g15015
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g15015
>Glyma14g15015.1   sequence type=CDS   gene model=Glyma14g15015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATCATTGTTCGTCGTTGGGAAACGACCTAGGATCACTTCCTAATTACTACATCTTAATCCCACACGCCACACCTGTCAGTTTTAGACACTCCCCCTTCATTCCCTTAATCACTCCCTTCCCTTCTCGATCTCACACAACAGCTCCAACCATCGCAGGGGCCATCCTGGGCCTCATATTTTTCCTCCCCTTAATCATCTTATCAAGCCCAGTGTGGGTCCCAGCCGGCACCCTCGTATTCATCGTCACCGCAGGGTTCTTGTCCGTGTGCGGTTTCGGCGTTGCACTCGTGGCCGCGCTGTCGTGGATGTACCGTTACTTCAGGGGGCTCCACCCGCCCGGTTCCGACCGCGTCGACTACGCGCGGACCCGCATTTACGACACCGCCAGCCACGTCAAAGACTACGCCAGAGACTACAGAGGCTATTTGCAGAGTAAGGTTAAAGATGCAGCTCCCGGTGCGTGA
Predicted protein sequences of Glyma14g15015
>Glyma14g15015.1   sequence type=predicted peptide   gene model=Glyma14g15015   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYHCSSLGNDLGSLPNYYILIPHATPVSFRHSPFIPLITPFPSRSHTTAPTIAGAILGLIFFLPLIILSSPVWVPAGTLVFIVTAGFLSVCGFGVALVAALSWMYRYFRGLHPPGSDRVDYARTRIYDTASHVKDYARDYRGYLQSKVKDAAPGA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo