SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g14500

Feature Type:gene_model
Chromosome:Gm14
Start:14671273
stop:14674594
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g14500
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G32400AT Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein | chr4:15638686-15640238 FORWARD LENGTH=392 SoyBaseE_val: 9.00E-174ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006839GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondrial transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005743GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015215GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide transmembrane transporter activity SoyBaseN/AISS
KOG0752 KOG Mitochondrial solute carrier protein JGI ISS
PTHR24089Panther FAMILY NOT NAMED JGI ISS
PTHR24089:SF87Panther SUBFAMILY NOT NAMED JGI ISS
PF00153PFAM Mitochondrial carrier protein JGI ISS
UniRef100_G7JB41UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein brittle-1 n=1 Tax=Medicago truncatula RepID=G7JB41_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1M9J7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M9J7_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma14g14500
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g14500 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g14500
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g14500
>Glyma14g14500.1   sequence type=CDS   gene model=Glyma14g14500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAGGAGAGGGGTCAAGCTATTCGATGAAGAAAAGAACGGTCTTTTTTCAATTTCCAATTTTGGGTCTCAATGGGGTGGTGGTGGTGTTCACGACCCTGTGAATTTGGCTGTGATGGCAAGCATTAGTCGAATGGGAATGGGGTTTGGTGTTCAACAACCAAACCCTTCTTCTTCTGATGATAATAATTCCCAGCACAACGGTGGCATGAGCATGAGTATGAGGATTCCGTGCACCGAGTTGTACGTTCGGTACGTGCAATCCGAGGGGAAGGTGAAGATTCTCGGGGTTCCTGAGGAGGAAGAGGTGGTGGAGGGGGTGAAAAAGAAGAAAAAGGGTGGTGCCTTTAAAGGGTTGAGGATTAAGGTGAAGAACCCTTCTCTTAGGAGGTTGGTTAGCGGTGCCTTTGCTGGGGCGGTTTCACGGACCACTGTGGCGCCCTTGGAGACGATAAGGACTCATTTGATGGTGGGGGGTAGTGGCAATTCCACTGGGGAGGTGTTCAGGAATATCATGAAGACTGATGGGTGGAAGGGCTTGTTTAGGGGTAATTTCGTTAATGTGATTCGGGTTGCTCCTGGCAAGGCCATTGAGCTATTTGCTTATGATACTGTTAACAAGAACCTCTCGCCAAAGCCAGGGGAGCAGCCCAAACTCCCTATTCCAGCATCATTGATAGCAGGTGCTTGTGCTGGAGTTAGTTCAACTATATGCACTTATCCTCTAGAGTTACTAAAGACTCGACTAACTATCCAGAGGGGTGTTTATGATGGTCTTGTAGATGCATTCCTGAAAATAGTTAGAGAGGAAGGTGCAGGAGAACTTTACAGAGGCCTTACTCCGAGTCTGATTGGAGTAATTCCATATTCTGCCACCAATTACTTTGCCTATGACACCTTGAGGAAAGCATACAGAAAAATTTTCAAGAAAGAGAAGATTGGCAACATTGAAACCCTTTTGATAGGATCAGCAGCTGGTGCTATTTCAAGTAGTGCTACCTTTCCGCTCGAAGTGGCTCGCAAACACATGCAAGTGGGAGCCCTTAGTGGAAGACAAGTATACAAAAATGTGATTCATGCCCTTGCAAGCATTCTTGAACAAGAAGGAATCCAAGGATTGTATAAAGGGTTGGGACCTAGCTGCATGAAGTTGGTGCCAGCTGCAGGAATTTCTTTCATGTGCTATGAAGCATGCAAGAGGATACTAGTAGAGGACGACGATGATGAGGAGTGA
Predicted protein sequences of Glyma14g14500
>Glyma14g14500.1   sequence type=predicted peptide   gene model=Glyma14g14500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRGVKLFDEEKNGLFSISNFGSQWGGGGVHDPVNLAVMASISRMGMGFGVQQPNPSSSDDNNSQHNGGMSMSMRIPCTELYVRYVQSEGKVKILGVPEEEEVVEGVKKKKKGGAFKGLRIKVKNPSLRRLVSGAFAGAVSRTTVAPLETIRTHLMVGGSGNSTGEVFRNIMKTDGWKGLFRGNFVNVIRVAPGKAIELFAYDTVNKNLSPKPGEQPKLPIPASLIAGACAGVSSTICTYPLELLKTRLTIQRGVYDGLVDAFLKIVREEGAGELYRGLTPSLIGVIPYSATNYFAYDTLRKAYRKIFKKEKIGNIETLLIGSAAGAISSSATFPLEVARKHMQVGALSGRQVYKNVIHALASILEQEGIQGLYKGLGPSCMKLVPAAGISFMCYEACKRILVEDDDDEE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo