Glyma14g14500 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g14500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g14500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g14500

Feature Type:	gene_model
Chromosome:	Gm14
Start:	14671273
stop:	14674594
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g14500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32400	AT	Annotation by Michelle Graham. TAIR10: Mitochondrial substrate carrier family protein \| chr4:15638686-15640238 FORWARD LENGTH=392	SoyBase	E_val: 9.00E-174	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0006820	GO-bp	Annotation by Michelle Graham. GO Biological Process: anion transport	SoyBase	N/A	ISS
GO:0006839	GO-bp	Annotation by Michelle Graham. GO Biological Process: mitochondrial transport	SoyBase	N/A	ISS
GO:0006862	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide transport	SoyBase	N/A	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0009165	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0015696	GO-bp	Annotation by Michelle Graham. GO Biological Process: ammonium transport	SoyBase	N/A	ISS
GO:0015802	GO-bp	Annotation by Michelle Graham. GO Biological Process: basic amino acid transport	SoyBase	N/A	ISS
GO:0043069	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death	SoyBase	N/A	ISS
GO:0043090	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid import	SoyBase	N/A	ISS
GO:0043269	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of ion transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0015215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide transmembrane transporter activity	SoyBase	N/A	ISS
KOG0752	KOG	Mitochondrial solute carrier protein	JGI		ISS
PTHR24089	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24089:SF87	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00153	PFAM	Mitochondrial carrier protein	JGI		ISS
UniRef100_G7JB41	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein brittle-1 n=1 Tax=Medicago truncatula RepID=G7JB41_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_I1M9J7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M9J7_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma14g14500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g14500 not represented in the dataset	Glyma14g14500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g14500 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g14500

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g14500

Limit To All Plant Sequences

>Glyma14g14500.1   sequence type=CDS   gene model=Glyma14g14500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAGGAGAGGGGTCAAGCTATTCGATGAAGAAAAGAACGGTCTTTTTTCAATTTCCAATTTTGGGTCTCAATGGGGTGGTGGTGGTGTTCACGACCCTGTGAATTTGGCTGTGATGGCAAGCATTAGTCGAATGGGAATGGGGTTTGGTGTTCAACAACCAAACCCTTCTTCTTCTGATGATAATAATTCCCAGCACAACGGTGGCATGAGCATGAGTATGAGGATTCCGTGCACCGAGTTGTACGTTCGGTACGTGCAATCCGAGGGGAAGGTGAAGATTCTCGGGGTTCCTGAGGAGGAAGAGGTGGTGGAGGGGGTGAAAAAGAAGAAAAAGGGTGGTGCCTTTAAAGGGTTGAGGATTAAGGTGAAGAACCCTTCTCTTAGGAGGTTGGTTAGCGGTGCCTTTGCTGGGGCGGTTTCACGGACCACTGTGGCGCCCTTGGAGACGATAAGGACTCATTTGATGGTGGGGGGTAGTGGCAATTCCACTGGGGAGGTGTTCAGGAATATCATGAAGACTGATGGGTGGAAGGGCTTGTTTAGGGGTAATTTCGTTAATGTGATTCGGGTTGCTCCTGGCAAGGCCATTGAGCTATTTGCTTATGATACTGTTAACAAGAACCTCTCGCCAAAGCCAGGGGAGCAGCCCAAACTCCCTATTCCAGCATCATTGATAGCAGGTGCTTGTGCTGGAGTTAGTTCAACTATATGCACTTATCCTCTAGAGTTACTAAAGACTCGACTAACTATCCAGAGGGGTGTTTATGATGGTCTTGTAGATGCATTCCTGAAAATAGTTAGAGAGGAAGGTGCAGGAGAACTTTACAGAGGCCTTACTCCGAGTCTGATTGGAGTAATTCCATATTCTGCCACCAATTACTTTGCCTATGACACCTTGAGGAAAGCATACAGAAAAATTTTCAAGAAAGAGAAGATTGGCAACATTGAAACCCTTTTGATAGGATCAGCAGCTGGTGCTATTTCAAGTAGTGCTACCTTTCCGCTCGAAGTGGCTCGCAAACACATGCAAGTGGGAGCCCTTAGTGGAAGACAAGTATACAAAAATGTGATTCATGCCCTTGCAAGCATTCTTGAACAAGAAGGAATCCAAGGATTGTATAAAGGGTTGGGACCTAGCTGCATGAAGTTGGTGCCAGCTGCAGGAATTTCTTTCATGTGCTATGAAGCATGCAAGAGGATACTAGTAGAGGACGACGATGATGAGGAGTGA

Predicted protein sequences of Glyma14g14500

Limit To All Plant Sequences

>Glyma14g14500.1   sequence type=predicted peptide   gene model=Glyma14g14500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRRGVKLFDEEKNGLFSISNFGSQWGGGGVHDPVNLAVMASISRMGMGFGVQQPNPSSSDDNNSQHNGGMSMSMRIPCTELYVRYVQSEGKVKILGVPEEEEVVEGVKKKKKGGAFKGLRIKVKNPSLRRLVSGAFAGAVSRTTVAPLETIRTHLMVGGSGNSTGEVFRNIMKTDGWKGLFRGNFVNVIRVAPGKAIELFAYDTVNKNLSPKPGEQPKLPIPASLIAGACAGVSSTICTYPLELLKTRLTIQRGVYDGLVDAFLKIVREEGAGELYRGLTPSLIGVIPYSATNYFAYDTLRKAYRKIFKKEKIGNIETLLIGSAAGAISSSATFPLEVARKHMQVGALSGRQVYKNVIHALASILEQEGIQGLYKGLGPSCMKLVPAAGISFMCYEACKRILVEDDDDEE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain