Glyma14g14181 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g14181

Feature Type:	gene_model
Chromosome:	Gm14
Start:	13888562
stop:	13890438
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g14181

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G30150	AT	Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Nucleolar 27S pre-rRNA processing, Urb2/Npa2 (InterPro:IPR018849); Has 58 Blast hits to 49 proteins in 21 species: Archae - 0; Bacteria - 2; Metazoa - 2; Fungi - 0; Plants - 44; Viruses - 3; Other Eukaryotes - 7 (source: NCBI BLink). \| chr4:14742452-14749764 FORWARD LENGTH=2009	SoyBase	E_val: 6.00E-30	ISS
PF10441	PFAM	Urb2/Npa2 family	JGI		ISS
UniRef100_Q10QA7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=2 Tax=Oryza sativa Japonica Group RepID=Q10QA7_ORYSJ	SoyBase	E_val: 1.00E-16	ISS
UniRef100_UPI0002337E2D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002337E2D related cluster n=1 Tax=unknown RepID=UPI0002337E2D	SoyBase	E_val: 4.00E-50	ISS

Expression Patterns of Glyma14g14181

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g14181 not represented in the dataset	Glyma14g14181 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g14181 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g115300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g14181

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g14181

Limit To All Plant Sequences

>Glyma14g14181.1   sequence type=CDS   gene model=Glyma14g14181   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAATAAAGTTTGCTTTTCTTCAGAAGAGGGAGTGGCATGTGCTTCTTCTCTTCGAAGAATTTATGAAGAGATAAACAAGCAAAAACATATCTTTGGTCGTCAATGTTCTCTGTTTTTATCCAATTACGTATGGGTTTATTCAGGATATGGTGATCACAAGAGAAGTGGCATCAGAAGAGAAGTGGATGAATCTCTAAGACTGGGTGTCGATGCTTCAATAGATGCTTGCTCACGTGATGATATTCAATATCTTCATACTGTATTTGGGGGTAAGTAA

Predicted protein sequences of Glyma14g14181

Limit To All Plant Sequences

>Glyma14g14181.1   sequence type=predicted peptide   gene model=Glyma14g14181   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNKVCFSSEEGVACASSLRRIYEEINKQKHIFGRQCSLFLSNYVWVYSGYGDHKRSGIRREVDESLRLGVDASIDACSRDDIQYLHTVFGGK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain