SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g14100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g14100): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g14100

Feature Type:gene_model
Chromosome:Gm14
Start:13827831
stop:13829987
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30270AT Annotation by Michelle Graham. TAIR10: CBL-interacting protein kinase 23 | chr1:10655270-10658524 FORWARD LENGTH=482 SoyBaseE_val: 1.00E-97ISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007584GO-bp Annotation by Michelle Graham. GO Biological Process: response to nutrient SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0010107GO-bp Annotation by Michelle Graham. GO Biological Process: potassium ion import SoyBaseN/AISS
GO:0010118GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal movement SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0019722GO-bp Annotation by Michelle Graham. GO Biological Process: calcium-mediated signaling SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG0616 KOG cAMP-dependent protein kinase catalytic subunit (PKA) JGI ISS
PTHR24343Panther SERINE/THREONINE KINASE JGI ISS
PTHR24343:SF133Panther JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_C0M519UniRef Annotation by Michelle Graham. Most informative UniRef hit: CBL-interacting protein kinase 24 n=1 Tax=Populus euphratica RepID=C0M519_POPEU SoyBaseE_val: 1.00E-99ISS
UniRef100_I1M9H7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M9H7_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g14100 not represented in the dataset

Glyma14g14100 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g114700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g14100.2   sequence type=CDS   gene model=Glyma14g14100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGGGTTTCGCAACCTCCGCCATCGTGAGGCTTGCAAGTGACGTGACCACCGGACGCGGCGTGGCCATCAAAATTTTCGACAAGGACATCATTGACGCTAAGAAAAAAATCTATCAATCACACCCGAATATCGTGCGTATAATTGAGGTGATGGCTACCACGGCAAGGGTATATATTGTAATGGAACTTGTAATTGGTGGTGGACCACTGCTTGATAAAATTAACTTCTCACGCCTACCGGGACGAACATCGGGAATGTCAGAAACCAAAGCAAGACACTATTTTCATCAGCTTATATGTGCTGTGGATTGCTGTCACAGAAGAGGCGTTATCCATAGAGACCTGAAGCAGTCAAATTTGTTGCTGGATGCTGATGGAGTGCTTAGAGTGTCAGATTTTGGAATGAGTGCACTGCCTCAACAAGCTAGACAAGATGGGCTGCTTCACTCAGCATGTGGTGCGCTTGATTATATAGCCCCAGAGGTGATAAGGAACCGGGGCTATGAGGGTAAAAAGGCTGATATATGGTCATGTGGTGCTATTCTGTTTCATTTAGTTGCTGGTTATGTGCCCTTCAGAAATGAATATGACGACCGCAATACTAAAATTAGACAGATTCTCCAGGCTGACTTCATCTGTCCCTCATTTTTCTCTTCAAGTTTAATAACACTGATTAGGAGAATCCTTGATCCCAATCCTACTACACGGATTACAATGAATGAGATCTTTGAGAATGAATGGTTCATGCAGAATTATCAGCCTCCTAGATTTTTCAGGCAAAATTTTAGTTTTGGTCATCGTGTTGATAAGGGGGATGAAGCAGGGTCTTCAGCACCACCAGTGCCAGTCATGAATGCGTTTGAGATTTTGAATACATTTCTGGGCTACAACCTTATTATTGGAAAGCTTTTAAACCAGCTG

>Glyma14g14100.2   sequence type=predicted peptide   gene model=Glyma14g14100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGFATSAIVRLASDVTTGRGVAIKIFDKDIIDAKKKIYQSHPNIVRIIEVMATTARVYIVMELVIGGGPLLDKINFSRLPGRTSGMSETKARHYFHQLICAVDCCHRRGVIHRDLKQSNLLLDADGVLRVSDFGMSALPQQARQDGLLHSACGALDYIAPEVIRNRGYEGKKADIWSCGAILFHLVAGYVPFRNEYDDRNTKIRQILQADFICPSFFSSSLITLIRRILDPNPTTRITMNEIFENEWFMQNYQPPRFFRQNFSFGHRVDKGDEAGSSAPPVPVMNAFEILNTFLGYNLIIGKLLNQL







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo