SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g14080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g14080): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g14080

Feature Type:gene_model
Chromosome:Gm14
Start:13824744
stop:13824962
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G77990AT Annotation by Michelle Graham. TAIR10: STAS domain / Sulfate transporter family | chr1:29317965-29323249 REVERSE LENGTH=677 SoyBaseE_val: 2.00E-16ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0008272GO-bp Annotation by Michelle Graham. GO Biological Process: sulfate transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0008271GO-mf Annotation by Michelle Graham. GO Molecular Function: secondary active sulfate transmembrane transporter activity SoyBaseN/AISS
GO:0015116GO-mf Annotation by Michelle Graham. GO Molecular Function: sulfate transmembrane transporter activity SoyBaseN/AISS
PTHR11814Panther SULFATE TRANSPORTER JGI ISS
PTHR11814:SF46Panther SUBFAMILY NOT NAMED JGI ISS
PF00916PFAM Sulfate transporter family JGI ISS
UniRef100_G7KA22UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sulfate transporter-like protein n=1 Tax=Medicago truncatula RepID=G7KA22_MEDTR SoyBaseE_val: 4.00E-14ISS
UniRef100_I1KA21UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KA21_SOYBN SoyBaseE_val: 1.00E-15ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g14080 not represented in the dataset

Glyma14g14080 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g14080.1   sequence type=CDS   gene model=Glyma14g14080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTGATGCCATTGCTGGATCTTTGAGTTCATGCTATGTGGCAACTGGTTCTTTCTCAAGGACTGCAGTGAATTTCAGTGCTGGATGTCAAACATCAGTATCAAATATTGTGATGGTCGTTACAGTGTTT

>Glyma14g14080.1   sequence type=predicted peptide   gene model=Glyma14g14080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FDAIAGSLSSCYVATGSFSRTAVNFSAGCQTSVSNIVMVVTVF







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo