SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g14060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g14060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g14060

Feature Type:gene_model
Chromosome:Gm14
Start:13813381
stop:13815858
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g14060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G11060AT Annotation by Michelle Graham. TAIR10: KNOTTED1-like homeobox gene 4 | chr5:3510408-3512967 FORWARD LENGTH=393 SoyBaseE_val: 7.00E-29ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0048513GO-bp Annotation by Michelle Graham. GO Biological Process: organ development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR21493Panther CGI-141-RELATED/LIPASE CONTAINING PROTEIN JGI ISS
PTHR21493:SF2Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_F5A6B5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Knotted-like homeobox KNOX5 n=1 Tax=Fragaria vesca RepID=F5A6B5_FRAVE SoyBaseE_val: 7.00E-31ISS
UniRef100_UPI000233BCB6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BCB6 related cluster n=1 Tax=unknown RepID=UPI000233BCB6 SoyBaseE_val: 8.00E-59ISS

Expression Patterns of Glyma14g14060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g14060 not represented in the dataset
Glyma14g14060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g14060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g114500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g14060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g14060
>Glyma14g14060.1   sequence type=CDS   gene model=Glyma14g14060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGCATGATTTAACAGGAGTTTCACCCGGGGAAGGCACGGGAGCAACAATGTCTGATGACGAAGATGAGCAAGTAGGTAGTGATGCCAATCTGTTTGATGGTGCTTTGGATGGTCCTGATAGCATGGGATTCGGTCCTCTTATTCCCACAGAGAATGAGAGGTCCCTCACGGAACGTGTAAGACCTGAAGTAAAGCACGAATTGAAACAGGAGACTTGTTGTGCCTTGGTGACTTGTTGGTCATGGGTTCGAATCCGGAAACAGCCTCTTTGCATATGCAAGGTTGTGTTTCGTGCGTTTTTACTGGCTGCTGGAATCCCCAACAAGGATGTTCTCCTACGGAAGAAAAGGGCTAGGATTCTAAAGCCAGCTTTCACAGTTATACGGGATAAAGAATCAAAATGTTTGCTTGTGTTCATCCGTGGAACTCAAAGCTTAAAAGACACACTGACAGAAGCAATCGGTGCTCCCGTGTCCTTCAATCATTTCATTTGA
Predicted protein sequences of Glyma14g14060
>Glyma14g14060.1   sequence type=predicted peptide   gene model=Glyma14g14060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVHDLTGVSPGEGTGATMSDDEDEQVGSDANLFDGALDGPDSMGFGPLIPTENERSLTERVRPEVKHELKQETCCALVTCWSWVRIRKQPLCICKVVFRAFLLAAGIPNKDVLLRKKRARILKPAFTVIRDKESKCLLVFIRGTQSLKDTLTEAIGAPVSFNHFI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo