SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g14050

Feature Type:gene_model
Chromosome:Gm14
Start:13809684
stop:13810587
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g14050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15850AT Annotation by Michelle Graham. TAIR10: RNA helicase 1 | chr4:9001426-9004534 FORWARD LENGTH=522 SoyBaseE_val: 7.00E-78ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
GO:0017151GO-mf Annotation by Michelle Graham. GO Molecular Function: DEAD/H-box RNA helicase binding SoyBaseN/AISS
PTHR24031Panther FAMILY NOT NAMED JGI ISS
PTHR24031:SF18Panther SUBFAMILY NOT NAMED JGI ISS
PF00270PFAM DEAD/DEAH box helicase JGI ISS
UniRef100_G7KG11UniRef Annotation by Michelle Graham. Most informative UniRef hit: DEAD-box ATP-dependent RNA helicase n=1 Tax=Medicago truncatula RepID=G7KG11_MEDTR SoyBaseE_val: 6.00E-91ISS
UniRef100_UPI000233BCB4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BCB4 related cluster n=1 Tax=unknown RepID=UPI000233BCB4 SoyBaseE_val: 5.00E-175ISS

Expression Patterns of Glyma14g14050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g14050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g114400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g14050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g14050
>Glyma14g14050.2   sequence type=CDS   gene model=Glyma14g14050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAAGAAAAGCAGCAGCCAAGTGTGGTGGTTCTACCATGGATGCGCCACCCTGTCGACATCACTCGCTATCAAGAACTCCCTATATGTAGTGTTCCTTTGATGAAACGCAGGTCACACTCTGAAACGGTTGGACCGGGTGACTTTGAGCGAGACCTTTGCATAAAATTACCCATCGAAAGTGGCAAAACTTTGGCCTATGCTTTTCCCATCGTTCAAAACTTGTCCACCGACACCGGTGGCCGCCTCCGTGCTTTGGTTGTAGTTCCCACCCGCGACCTTTCTTTGCAGGTTAAGCGTGTCTTCGACGCCCTTGCATCATTGTTGGGTCTCCGTATTTGCTTGGCTACTGATCAATCTTCGCTTCGCCACAAGCTTTCTAGCCTCATTTATCTACCTGGAGAAGACGATGGTCAAGATCCTGGGTTTTTGTCTTCGTTGTGGTTCCAAAGCAAGGTCGACATATTGGTAGTGACCCCTGGAAGGCTAGTGGACCATGTCAACAAGTTGTCGTTGAAGCATCTTCGTTATCTCATGGTTGACGAAGCAGATCGATTGCTACGCGAGGACTACCAGTCCTGGTTACCTACTGTGCTTAAATTAACTCAATCTAGGCTGACAAAGATAGTTTTATCTGCTACATTAACTCGAGACCCAGGAAGGCTTGCTCAACTTAATTTGCATCACCCTTTATTCCTGAGTACTGGGAAAATGCGTTATCGACTCCCAGAATATTTGGAATGTTACAAACTGGTATATGACACTGCATAG
Predicted protein sequences of Glyma14g14050
>Glyma14g14050.2   sequence type=predicted peptide   gene model=Glyma14g14050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEEKQQPSVVVLPWMRHPVDITRYQELPICSVPLMKRRSHSETVGPGDFERDLCIKLPIESGKTLAYAFPIVQNLSTDTGGRLRALVVVPTRDLSLQVKRVFDALASLLGLRICLATDQSSLRHKLSSLIYLPGEDDGQDPGFLSSLWFQSKVDILVVTPGRLVDHVNKLSLKHLRYLMVDEADRLLREDYQSWLPTVLKLTQSRLTKIVLSATLTRDPGRLAQLNLHHPLFLSTGKMRYRLPEYLECYKLVYDTA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo