Glyma14g13370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g13370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g13370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g13370

Feature Type:	gene_model
Chromosome:	Gm14
Start:	12773231
stop:	12773865
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g13370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G16480	AT	Annotation by Michelle Graham. TAIR10: mitochondrial processing peptidase alpha subunit \| chr3:5599906-5602716 FORWARD LENGTH=499	SoyBase	E_val: 2.00E-49	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0051788	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to misfolded protein	SoyBase	N/A	ISS
GO:0080129	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005741	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005750	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III	SoyBase	N/A	ISS
GO:0005758	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space	SoyBase	N/A	ISS
GO:0005759	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009536	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004222	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
PTHR11851	Panther	METALLOPROTEASE	JGI		ISS
PTHR11851:SF69	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF05193	PFAM	Peptidase M16 inactive domain	JGI		ISS
UniRef100_G7L7C9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial-processing peptidase subunit alpha n=1 Tax=Medicago truncatula RepID=G7L7C9_MEDTR	SoyBase	E_val: 2.00E-78	ISS
UniRef100_UPI000233BB50	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BB50 related cluster n=1 Tax=unknown RepID=UPI000233BB50	SoyBase	E_val: 2.00E-91	ISS

Expression Patterns of Glyma14g13370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g13370 not represented in the dataset	Glyma14g13370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g13370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g13370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g13370

Limit To All Plant Sequences

>Glyma14g13370.1   sequence type=CDS   gene model=Glyma14g13370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTAACGAGCAGCTTCTGAAAGTGAAGGCTGAGATTGGTGAAGCTTCCAAAAATCTCCAAGACTTACTTTTGGAAGCAATTCATTCTGCTGGTTTTTCTGGTGCCTTGGCAAATCCTCTTTTAGCTTCAGAATCAGCTCTAAATAGACTAAATGGTACAATTTTGGAGGAGTTTGTTACTGAGAACTATACAGCACCTCGGATAGTACTTGCAACATCTGGTGTTGAACATGAGGAATTGTTATTTGCTGCAGAACCTCTCTTGTCTGATCTACCCAGTGTTCCACGTCTAGAGGAGCCAAAATCAGTGTATACTGGTGGTGATTATAGATGTCAAAGTGAATCAGGGAGGACCCATTTTGCTCTAGCAGTTGAACTTCCTGGTGACTGGCATAAGTTGAAGGATGTTATG

Predicted protein sequences of Glyma14g13370

Limit To All Plant Sequences

>Glyma14g13370.1   sequence type=predicted peptide   gene model=Glyma14g13370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VNEQLLKVKAEIGEASKNLQDLLLEAIHSAGFSGALANPLLASESALNRLNGTILEEFVTENYTAPRIVLATSGVEHEELLFAAEPLLSDLPSVPRLEEPKSVYTGGDYRCQSESGRTHFALAVELPGDWHKLKDVM

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain