SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g13206): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g13206): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g13206

Feature Type:gene_model
Chromosome:Gm14
Start:12508804
stop:12509350
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80760AT Annotation by Michelle Graham. TAIR10: NOD26-like intrinsic protein 6;1 | chr1:30350640-30352015 REVERSE LENGTH=305 SoyBaseE_val: 3.00E-48ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0010264GO-bp Annotation by Michelle Graham. GO Biological Process: myo-inositol hexakisphosphate biosynthetic process SoyBaseN/AISS
GO:0046713GO-bp Annotation by Michelle Graham. GO Biological Process: borate transport SoyBaseN/AISS
GO:0080029GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to boron-containing substance levels SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015168GO-mf Annotation by Michelle Graham. GO Molecular Function: glycerol transmembrane transporter activity SoyBaseN/AISS
GO:0015204GO-mf Annotation by Michelle Graham. GO Molecular Function: urea transmembrane transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
GO:0046715GO-mf Annotation by Michelle Graham. GO Molecular Function: borate transmembrane transporter activity SoyBaseN/AISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF22Panther gb def: glycerol uptake facilitator protein [mycoplasma pulmonis] JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_Q6J1S8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nodulin 26-like protein n=1 Tax=Medicago truncatula RepID=Q6J1S8_MEDTR SoyBaseE_val: 6.00E-48ISS
UniRef100_UPI000233BB4CUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BB4C related cluster n=1 Tax=unknown RepID=UPI000233BB4C SoyBaseE_val: 2.00E-66ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g13206 not represented in the dataset

Glyma14g13206 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g109600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g13206.1   sequence type=CDS   gene model=Glyma14g13206   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCATCATATGCTTCATAGGTCACATCTCCGGGGCTCATCTCAACCCCGCTGTCACCATCTCTTTTGCTGCATTAAAGTACATCCCGTGGAAGAATGTGCCTGTGTATATTGGTGCACAAGTTTTGGCATCAGTGAGTGCTGCATTTGCTCTGAAGGCGCTTTTTCATCCGTACATGAGCGGTGGAGTGACGGTCCCTTCAGTGGGATATGGGCAAGCTTTCGCTATAGAGTTCATTGTCAGCTTTATGCTTATGTTCGTTGTCACTGCAGTGGCCACCCGCACAAGAGTTGTGAGTATTTTATTCTACTAA

>Glyma14g13206.1   sequence type=predicted peptide   gene model=Glyma14g13206   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIIICFIGHISGAHLNPAVTISFAALKYIPWKNVPVYIGAQVLASVSAAFALKALFHPYMSGGVTVPSVGYGQAFAIEFIVSFMLMFVVTAVATRTRVVSILFY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo