SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g13011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g13011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g13011

Feature Type:gene_model
Chromosome:Gm14
Start:12077624
stop:12082073
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g13011
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62460AT Annotation by Michelle Graham. TAIR10: RING/FYVE/PHD zinc finger superfamily protein | chr5:25075545-25077072 FORWARD LENGTH=307 SoyBaseE_val: 5.00E-42ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF12428PFAM Protein of unknown function (DUF3675) JGI ISS
UniRef100_G7KF81UniRef Annotation by Michelle Graham. Most informative UniRef hit: E3 ubiquitin-protein ligase MARCH3 n=1 Tax=Medicago truncatula RepID=G7KF81_MEDTR SoyBaseE_val: 5.00E-49ISS
UniRef100_UPI00018C6E5AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI00018C6E5A related cluster n=1 Tax=unknown RepID=UPI00018C6E5A SoyBaseE_val: 5.00E-58ISS

Expression Patterns of Glyma14g13011
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g13011 not represented in the dataset
Glyma14g13011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g13011 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g108300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g13011
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g13011
>Glyma14g13011.1   sequence type=CDS   gene model=Glyma14g13011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTGATCACTTGGTAGTGTTCGTTGACCATCTCGCGTGCCATGTCCCCGTTGATTCGGAGAAGGACAGTGTTTCCAACTTGGAGACGCCTGGCGCCTATAGCAGTAGTCTTAAGTGTGTCCACCATTGGTGTGATGAGAAAGGAGACATAACTTGTGAGATATGTCTATCAGAGGTGGCTGGACAATATGGAACACCCTTGGAGTTTTGTGATCCTCGACTCTTGGCAATTGCAGAGGCAGAACGTCAGTTCTTGGATGTTGAATATGATGAGTATGCTGCTTCCAACGTTAGAGGAGTTGCATTTTTCCGTTCAACTACTTTAATTCCTAATTCATATTGTTTGGTGCAATTAATGGCCCTTTTACTCTTGTTGCGTGCATTTTCTGTCTCAAATGGTGATAATTCTAATGATGATCCATCCAATTTTTTCTCCCTTTTCTTGCTTCACGCTGCTAGATTTCTATTACCTTGCTACATCATGGCTTGGGCAATCAGTATTCTGCAGCATCGGCAACAAAGACAAGTCAGTCTTCATTATAGTTATTAA
Predicted protein sequences of Glyma14g13011
>Glyma14g13011.1   sequence type=predicted peptide   gene model=Glyma14g13011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDHLVVFVDHLACHVPVDSEKDSVSNLETPGAYSSSLKCVHHWCDEKGDITCEICLSEVAGQYGTPLEFCDPRLLAIAEAERQFLDVEYDEYAASNVRGVAFFRSTTLIPNSYCLVQLMALLLLLRAFSVSNGDNSNDDPSNFFSLFLLHAARFLLPCYIMAWAISILQHRQQRQVSLHYSY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo