Glyma14g13000 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g13000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g13000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g13000

Feature Type:	gene_model
Chromosome:	Gm14
Start:	12046724
stop:	12048795
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g13000

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G43190	AT	Annotation by Michelle Graham. TAIR10: sucrose synthase 4 \| chr3:15179204-15182577 REVERSE LENGTH=808	SoyBase	E_val: 1.00E-33	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0005986	GO-bp	Annotation by Michelle Graham. GO Biological Process: sucrose biosynthetic process	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008194	GO-mf	Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity	SoyBase	N/A	ISS
GO:0016157	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sucrose synthase activity	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
PTHR12526	Panther	GLYCOSYLTRANSFERASE	JGI		ISS
PTHR12526:SF27	Panther	SUCROSE SYNTHASE	JGI		ISS
PF00862	PFAM	Sucrose synthase	JGI		ISS
UniRef100_Q7Y1Y7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sucrose UDP-glucosyltransferase (Fragment) n=1 Tax=Casuarina glauca RepID=Q7Y1Y7_CASGL	SoyBase	E_val: 1.00E-37	ISS
UniRef100_Q7Y1Y7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Sucrose UDP-glucosyltransferase (Fragment) n=1 Tax=Casuarina glauca RepID=Q7Y1Y7_CASGL	SoyBase	E_val: 1.00E-37	ISS

Expression Patterns of Glyma14g13000

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g13000 not represented in the dataset	Glyma14g13000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g13000 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g13000

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g13000

Limit To All Plant Sequences

>Glyma14g13000.1   sequence type=CDS   gene model=Glyma14g13000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACATTTCTTGGAAGAGTTCATATGGTCTTCAATGTTGTTATCCTTTCTCCCCATTGTTACTTTGCCCAAGATAATGTCTTGGGGTACCCTGACACTGGTGGACAGGTTGTTTACATCTTGGATCAAGTTCGTTTCGTAAAACATAGCTTATTTATAGATTACTTGTCTTCTCCCTCATGCAATAGGAACTACCTATGGCCATTTAGAGAGGTTCCTTTCAGAACCAAAAAGGAAAATTTTCACAAATGGATCTCAAGATTCGAAGTCTGGCCATACCTAGAGACTTACACTGACGTGAATTTTAACTTTTACTCAGAACTGATGTTGCCCTTGAACTTGCCAAGGAGAGTAACTCAGGTTTGTATATATAGACACCTACTTTCTAGTAAATTGAACTCTTTCTCTTTACCATCTCTTGTTTGGATTGAAAGTGCAGTTGACCACAACAAGCCAATCATCTTCACTATGGCAAGACTTGACCGTGTGAAGAACATCACAGGACTTGTCATGTGGTATGGCAAGAATGCGCGCCTCTGCGAGTTGGTAAACCTCGTCGTGGTGGTCGGAGACAAGAGGAAGGAATCCAAAGACTTGGAAGAGAAGGCCGAGATGAATAATATGTATGGCCTCATCGAGACCTACAAGTTAAAAGACCAATTCCGATGGATCTCCTCTCAAATTTATGTCAAAAACCGTCTTAGAATCCTATACATACTTAGAAAACCCGTTTTATGCAAAATAACCGACTTAGAAACACGTTTTTCTAACCCCCAAACCTCTTTTCTTCCTATACCTCGTAATCTTCTTCCAACCCACCATATGAATCCCTTTCCCCTAGAAACCCTTCCAAATAAAACTACA

Predicted protein sequences of Glyma14g13000

Limit To All Plant Sequences

>Glyma14g13000.1   sequence type=predicted peptide   gene model=Glyma14g13000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TFLGRVHMVFNVVILSPHCYFAQDNVLGYPDTGGQVVYILDQVRFVKHSLFIDYLSSPSCNRNYLWPFREVPFRTKKENFHKWISRFEVWPYLETYTDVNFNFYSELMLPLNLPRRVTQVCIYRHLLSSKLNSFSLPSLVWIESAVDHNKPIIFTMARLDRVKNITGLVMWYGKNARLCELVNLVVVVGDKRKESKDLEEKAEMNNMYGLIETYKLKDQFRWISSQIYVKNRLRILYILRKPVLCKITDLETRFSNPQTSFLPIPRNLLPTHHMNPFPLETLPNKTT

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain