SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g13000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g13000): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g13000

Feature Type:gene_model
Chromosome:Gm14
Start:12046724
stop:12048795
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G43190AT Annotation by Michelle Graham. TAIR10: sucrose synthase 4 | chr3:15179204-15182577 REVERSE LENGTH=808 SoyBaseE_val: 1.00E-33ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0005986GO-bp Annotation by Michelle Graham. GO Biological Process: sucrose biosynthetic process SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008194GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-glycosyltransferase activity SoyBaseN/AISS
GO:0016157GO-mf Annotation by Michelle Graham. GO Molecular Function: sucrose synthase activity SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
PTHR12526Panther GLYCOSYLTRANSFERASE JGI ISS
PTHR12526:SF27Panther SUCROSE SYNTHASE JGI ISS
PF00862PFAM Sucrose synthase JGI ISS
UniRef100_Q7Y1Y7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Sucrose UDP-glucosyltransferase (Fragment) n=1 Tax=Casuarina glauca RepID=Q7Y1Y7_CASGL SoyBaseE_val: 1.00E-37ISS
UniRef100_Q7Y1Y7UniRef Annotation by Michelle Graham. Best UniRef hit: Sucrose UDP-glucosyltransferase (Fragment) n=1 Tax=Casuarina glauca RepID=Q7Y1Y7_CASGL SoyBaseE_val: 1.00E-37ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g13000 not represented in the dataset

Glyma14g13000 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g13000.1   sequence type=CDS   gene model=Glyma14g13000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACATTTCTTGGAAGAGTTCATATGGTCTTCAATGTTGTTATCCTTTCTCCCCATTGTTACTTTGCCCAAGATAATGTCTTGGGGTACCCTGACACTGGTGGACAGGTTGTTTACATCTTGGATCAAGTTCGTTTCGTAAAACATAGCTTATTTATAGATTACTTGTCTTCTCCCTCATGCAATAGGAACTACCTATGGCCATTTAGAGAGGTTCCTTTCAGAACCAAAAAGGAAAATTTTCACAAATGGATCTCAAGATTCGAAGTCTGGCCATACCTAGAGACTTACACTGACGTGAATTTTAACTTTTACTCAGAACTGATGTTGCCCTTGAACTTGCCAAGGAGAGTAACTCAGGTTTGTATATATAGACACCTACTTTCTAGTAAATTGAACTCTTTCTCTTTACCATCTCTTGTTTGGATTGAAAGTGCAGTTGACCACAACAAGCCAATCATCTTCACTATGGCAAGACTTGACCGTGTGAAGAACATCACAGGACTTGTCATGTGGTATGGCAAGAATGCGCGCCTCTGCGAGTTGGTAAACCTCGTCGTGGTGGTCGGAGACAAGAGGAAGGAATCCAAAGACTTGGAAGAGAAGGCCGAGATGAATAATATGTATGGCCTCATCGAGACCTACAAGTTAAAAGACCAATTCCGATGGATCTCCTCTCAAATTTATGTCAAAAACCGTCTTAGAATCCTATACATACTTAGAAAACCCGTTTTATGCAAAATAACCGACTTAGAAACACGTTTTTCTAACCCCCAAACCTCTTTTCTTCCTATACCTCGTAATCTTCTTCCAACCCACCATATGAATCCCTTTCCCCTAGAAACCCTTCCAAATAAAACTACA

>Glyma14g13000.1   sequence type=predicted peptide   gene model=Glyma14g13000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TFLGRVHMVFNVVILSPHCYFAQDNVLGYPDTGGQVVYILDQVRFVKHSLFIDYLSSPSCNRNYLWPFREVPFRTKKENFHKWISRFEVWPYLETYTDVNFNFYSELMLPLNLPRRVTQVCIYRHLLSSKLNSFSLPSLVWIESAVDHNKPIIFTMARLDRVKNITGLVMWYGKNARLCELVNLVVVVGDKRKESKDLEEKAEMNNMYGLIETYKLKDQFRWISSQIYVKNRLRILYILRKPVLCKITDLETRFSNPQTSFLPIPRNLLPTHHMNPFPLETLPNKTT







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo