SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g12810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g12810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g12810

Feature Type:gene_model
Chromosome:Gm14
Start:11786579
stop:11787857
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G25350AT Annotation by Michelle Graham. TAIR10: glutamine-tRNA ligase, putative / glutaminyl-tRNA synthetase, putative / GlnRS, putative | chr1:8889280-8894205 REVERSE LENGTH=795 SoyBaseE_val: 3.00E-45ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0006418GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation SoyBaseN/AISS
GO:0006424GO-bp Annotation by Michelle Graham. GO Biological Process: glutamyl-tRNA aminoacylation SoyBaseN/AISS
GO:0006425GO-bp Annotation by Michelle Graham. GO Biological Process: glutaminyl-tRNA aminoacylation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0043039GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004812GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity SoyBaseN/AISS
GO:0004819GO-mf Annotation by Michelle Graham. GO Molecular Function: glutamine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR10119Panther GLUTAMYL-TRNA SYNTHETASE JGI ISS
PTHR10119:SF15Panther GLUTAMINYL-TRNA SYNTHETASE JGI ISS
PF00749PFAM tRNA synthetases class I (E and Q), catalytic domain JGI ISS
UniRef100_I1NFK7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NFK7_SOYBN SoyBaseE_val: 9.00E-54ISS
UniRef100_P52780UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamine--tRNA ligase n=1 Tax=Lupinus luteus RepID=SYQ_LUPLU SoyBaseE_val: 2.00E-45ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g12810 not represented in the dataset

Glyma14g12810 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g12810.1   sequence type=CDS   gene model=Glyma14g12810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGATACAAATCCTGAAGCAGAAAAGAAAGAGTATATTGATCACATTGAAGAAATTGTTCAGTAGATGGGTTGGAAACCATTCAAGGTATATTACTTACACAAGTGATTACTTCCAAGAATTGTACGAATTAGCAGTGGAGCTCATAAAAAAGGGTCATGCTTATGTTGATCATCAGACACCTGATGAGATAAAGGAGCATAGGGAGAAGAAATTGAACAGTCCTTGGAGAGACAGGCCAATTTCAAAGCAATTTACCCCACACCCTCATGCTGGAGACAAATGGTGTATCTATCCAAGTTATGATTATGCACATTGCATTGTGGATTCTCTAGAGAATATCACACATTCAGTAAGTTGTCTTTCACTCAAAAATGTC

>Glyma14g12810.1   sequence type=predicted peptide   gene model=Glyma14g12810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMIQILKQKRKSILITLKKLFSRWVGNHSRYITYTSDYFQELYELAVELIKKGHAYVDHQTPDEIKEHREKKLNSPWRDRPISKQFTPHPHAGDKWCIYPSYDYAHCIVDSLENITHSVSCLSLKNV







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo