SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G25350 | AT | Annotation by Michelle Graham. TAIR10: glutamine-tRNA ligase, putative / glutaminyl-tRNA synthetase, putative / GlnRS, putative | chr1:8889280-8894205 REVERSE LENGTH=795 | SoyBase | E_val: 3.00E-45 | ISS |
| GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
| GO:0006418 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation | SoyBase | N/A | ISS |
| GO:0006424 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glutamyl-tRNA aminoacylation | SoyBase | N/A | ISS |
| GO:0006425 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glutaminyl-tRNA aminoacylation | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0043039 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation | SoyBase | N/A | ISS |
| GO:0048481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ovule development | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0004812 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity | SoyBase | N/A | ISS |
| GO:0004819 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glutamine-tRNA ligase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| PTHR10119 | Panther | GLUTAMYL-TRNA SYNTHETASE | JGI | ISS | |
| PTHR10119:SF15 | Panther | GLUTAMINYL-TRNA SYNTHETASE | JGI | ISS | |
| PF00749 | PFAM | tRNA synthetases class I (E and Q), catalytic domain | JGI | ISS | |
| UniRef100_I1NFK7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NFK7_SOYBN | SoyBase | E_val: 9.00E-54 | ISS |
| UniRef100_P52780 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glutamine--tRNA ligase n=1 Tax=Lupinus luteus RepID=SYQ_LUPLU | SoyBase | E_val: 2.00E-45 | ISS |
|
Glyma14g12810 not represented in the dataset |
Glyma14g12810 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g12810.1 sequence type=CDS gene model=Glyma14g12810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATGATACAAATCCTGAAGCAGAAAAGAAAGAGTATATTGATCACATTGAAGAAATTGTTCAGTAGATGGGTTGGAAACCATTCAAGGTATATTACTTACACAAGTGATTACTTCCAAGAATTGTACGAATTAGCAGTGGAGCTCATAAAAAAGGGTCATGCTTATGTTGATCATCAGACACCTGATGAGATAAAGGAGCATAGGGAGAAGAAATTGAACAGTCCTTGGAGAGACAGGCCAATTTCAAAGCAATTTACCCCACACCCTCATGCTGGAGACAAATGGTGTATCTATCCAAGTTATGATTATGCACATTGCATTGTGGATTCTCTAGAGAATATCACACATTCAGTAAGTTGTCTTTCACTCAAAAATGTC
>Glyma14g12810.1 sequence type=predicted peptide gene model=Glyma14g12810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MMIQILKQKRKSILITLKKLFSRWVGNHSRYITYTSDYFQELYELAVELIKKGHAYVDHQTPDEIKEHREKKLNSPWRDRPISKQFTPHPHAGDKWCIYPSYDYAHCIVDSLENITHSVSCLSLKNV
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
