Glyma14g12680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g12680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g12680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g12680

Feature Type:	gene_model
Chromosome:	Gm14
Start:	11548168
stop:	11549629
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g12680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G20650	AT	Annotation by Michelle Graham. TAIR10: copper transporter 5 \| chr5:6985481-6985921 REVERSE LENGTH=146	SoyBase	E_val: 4.00E-51	ISS
GO:0006825	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transport	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0015680	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular copper ion transport	SoyBase	N/A	ISS
GO:0035434	GO-bp	Annotation by Michelle Graham. GO Biological Process: copper ion transmembrane transport	SoyBase	N/A	ISS
GO:0005770	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: late endosome	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005375	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015089	GO-mf	Annotation by Michelle Graham. GO Molecular Function: high affinity copper ion transmembrane transporter activity	SoyBase	N/A	ISS
KOG3386	KOG	Copper transporter	JGI		ISS
PTHR12483	Panther	SOLUTE CARRIER FAMILY 31 (COPPER TRANSPORTERS)	JGI		ISS
PTHR12483:SF1	Panther	gb def: f31e8.4.p [caenorhabditis elegans]	JGI		ISS
PF04145	PFAM	Ctr copper transporter family	JGI		ISS
UniRef100_G7I8Y2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Copper transporter n=1 Tax=Medicago truncatula RepID=G7I8Y2_MEDTR	SoyBase	E_val: 8.00E-63	ISS
UniRef100_I1M9C4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M9C4_SOYBN	SoyBase	E_val: 1.00E-102	ISS

Expression Patterns of Glyma14g12680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g12680 not represented in the dataset	Glyma14g12680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g12680

Paralog	Evidence	Comments
Glyma17g33491	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g12680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g107100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g12680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g12680

Limit To All Plant Sequences

>Glyma14g12680.2   sequence type=CDS   gene model=Glyma14g12680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGATAAGTCGGAGAAAAATTATTTTTTAATTGAGATTAATTTGGTGGTTGTTGGAAATTTTCTTATTCGTCGCCTACAAAACAATAAAAACCCTCGAAAATTTCAAAACATAGCGTTTTCTTCTTCTCGTGGTTCCGTGTCTGTCAGATATTTCTCAAGTGCGAAAATGATGCACATGACATTTTACTGGGGCAAGAAGGTGACGATCTTGATCGATTCATGGAAGACAGATTCCTGGACGAGTTACTTTCTGAGTCTACTCGCCTGCCTCGTCGCTGCCGCGTTATACCAGTACCTCGAGAATCGTCGGATTCGCCTGAAGCTCCTCGCCGGCGGCCGGAGGCCCTCGCCGGCGCCGGAGATCCGCGCTCCTCTTCTCCGGTGGGGCGTCGCCGGCGACAAGGAGAAGTTGGGGGTCAAGTTTGCGGAAGCGGTTCTGTTCGGGGTTAACTCGGCGATCGGGTACTTGTTGATGTTGGCGGTCATGTCCTTCAATGGAGGGGTATTTTTGGCAATTGCGGTGGGTCTCACCATTGGTTATTTCTTCTTCAGGAATGAAGGAGAGAATGACGCGCTTGTTGTTGATAATAATTCTTGTGCATGTGCTTAG

Predicted protein sequences of Glyma14g12680

Limit To All Plant Sequences

>Glyma14g12680.2   sequence type=predicted peptide   gene model=Glyma14g12680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDKSEKNYFLIEINLVVVGNFLIRRLQNNKNPRKFQNIAFSSSRGSVSVRYFSSAKMMHMTFYWGKKVTILIDSWKTDSWTSYFLSLLACLVAAALYQYLENRRIRLKLLAGGRRPSPAPEIRAPLLRWGVAGDKEKLGVKFAEAVLFGVNSAIGYLLMLAVMSFNGGVFLAIAVGLTIGYFFFRNEGENDALVVDNNSCACA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain