Glyma14g12560 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g12560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g12560): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g12560

Feature Type:	gene_model
Chromosome:	Gm14
Start:	11378408
stop:	11378783
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g12560

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G13750	AT	Annotation by Michelle Graham. TAIR10: beta galactosidase 1 \| chr3:4511192-4515756 FORWARD LENGTH=847	SoyBase	E_val: 2.00E-33	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0032880	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein localization	SoyBase	N/A	ISS
GO:0042744	GO-bp	Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0009505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
GO:0004565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: beta-galactosidase activity	SoyBase	N/A	ISS
GO:0030246	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding	SoyBase	N/A	ISS
GO:0043169	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cation binding	SoyBase	N/A	ISS
PTHR23421	Panther	BETA-GALACTOSIDASE RELATED	JGI		ISS
PTHR23421:SF33	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_I1KUU7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1KUU7_SOYBN	SoyBase	E_val: 2.00E-35	ISS
UniRef100_I1KUU7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Beta-galactosidase n=1 Tax=Glycine max RepID=I1KUU7_SOYBN	SoyBase	E_val: 2.00E-35	ISS

Expression Patterns of Glyma14g12560

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g12560 not represented in the dataset	Glyma14g12560 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g12560 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g12560

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g12560

Limit To All Plant Sequences

>Glyma14g12560.1   sequence type=CDS   gene model=Glyma14g12560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGATTGGCCAGACAGCCAAAGTGGGGTCATCTAAAGGATTTACATAGAGCAATAAAACTCTGTGAACCTGCTTTAGTATTTGGAGATCCTACTGTACAACAGCTTGGAAACTATGAAGAGACTCATGTTTTTAGATCCAATGGCATTGGAAATCAGCATTACAACTTGCCTCCTTGGTCTATAAGCATTCTTCCTAACTGCAAGCACACTCTTTATAACACTACAAGG

Predicted protein sequences of Glyma14g12560

Limit To All Plant Sequences

>Glyma14g12560.1   sequence type=predicted peptide   gene model=Glyma14g12560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GLARQPKWGHLKDLHRAIKLCEPALVFGDPTVQQLGNYEETHVFRSNGIGNQHYNLPPWSISILPNCKHTLYNTTR

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain