|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG00530 | AT | Annotation by Michelle Graham. TAIR10: CemA-like proton extrusion protein-related | chrC:60741-61430 FORWARD LENGTH=229 | SoyBase | E_val: 1.00E-42 | ISS |
| GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
| GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| PF03040 | PFAM | CemA family | JGI | ISS | |
| UniRef100_P49160 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Chloroplast envelope membrane protein n=1 Tax=Glycine max RepID=CEMA_SOYBN | SoyBase | E_val: 8.00E-61 | ISS |
| UniRef100_P49160 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast envelope membrane protein n=1 Tax=Glycine max RepID=CEMA_SOYBN | SoyBase | E_val: 8.00E-61 | ISS |
|
Glyma14g12194 not represented in the dataset |
Glyma14g12194 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g12194.1 sequence type=CDS gene model=Glyma14g12194 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAAACACATATACAAAACTTGCGTACTGGAATCTATAAAGAAATAATCCAATTAATCAAAACACACAACAAAGATCGTATGAATACAATTTTGTACTTCTCGAAAAATATAATTTGTTTCTTTATTCTAAGCGGTTATTCTATTCTTGGATTCCATTCAACTCATGGTTGGGAACTAGTGATTGGTTTTGTCTATAAAGATTTTGGATTTGCTCAAAATGATCAAATTATATTTGGTCTTGTTTCCACTTCTCCTGTCATTCTAGATACAATTTTAAAATATTTGATTTTCCATTATTTAAATCGCGCATCTCCATCACTTGTAGTGATTTATCCTTCAATGAATGATTGA
>Glyma14g12194.1 sequence type=predicted peptide gene model=Glyma14g12194 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high METHIQNLRTGIYKEIIQLIKTHNKDRMNTILYFSKNIICFFILSGYSILGFHSTHGWELVIGFVYKDFGFAQNDQIIFGLVSTSPVILDTILKYLIFHYLNRASPSLVVIYPSMND*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||