SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g11986): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g11986): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g11986

Feature Type:gene_model
Chromosome:Gm14
Start:10640933
stop:10654748
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25150AT Annotation by Michelle Graham. TAIR10: TBP-associated factor 5 | chr5:8677117-8682058 FORWARD LENGTH=669 SoyBaseE_val: 1.00E-24ISS
GO:0000394GO-bp Annotation by Michelle Graham. GO Biological Process: RNA splicing, via endonucleolytic cleavage and ligation SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006366GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from RNA polymerase II promoter SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
PTHR19879Panther WD40 REPEAT PROTEIN JGI ISS
PF04494PFAM WD40 associated region in TFIID subunit JGI ISS
UniRef100_G7J9V2UniRef Annotation by Michelle Graham. Best UniRef hit: Transcription initiation factor TFIID subunit n=1 Tax=Medicago truncatula RepID=G7J9V2_MEDTR SoyBaseE_val: 4.00E-32ISS
UniRef100_G7J9V2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription initiation factor TFIID subunit n=1 Tax=Medicago truncatula RepID=G7J9V2_MEDTR SoyBaseE_val: 4.00E-32ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g11986 not represented in the dataset

Glyma14g11986 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g33880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g103500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g11986.1   sequence type=CDS   gene model=Glyma14g11986   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCTGAGGTGTGAAGGGGCTAGGGGCATGGATGAAGATCAAATAGAAGGTTGTGTGAGTGGGTATTTGAAGCAGAAAGGGTTTACGCAAAACGATGACCAACTTCAACTCACCAACACCGATTCATCTCTCCAACCTGATACTATCAATCGCGGCCTATTGGAGAGAGGTTCTGCTAGATACCATGATGGGTATGGTAGACTAAGATCGTGGGCATACAGATCACTTGACTCATACAAGCATGAGTTGCTGCGTGTGCTTTATCCACTATTTTTCCATTGCGTCATGGATCTTGTGGCAAAAGGGCATATTCAGGAAGTGTGTGCAGTGGCATTCCAACTGCAACCACATTGCTACTGGCTCCAGTGA

>Glyma14g11986.1   sequence type=predicted peptide   gene model=Glyma14g11986   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLRCEGARGMDEDQIEGCVSGYLKQKGFTQNDDQLQLTNTDSSLQPDTINRGLLERGSARYHDGYGRLRSWAYRSLDSYKHELLRVLYPLFFHCVMDLVAKGHIQEVCAVAFQLQPHCYWLQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo