Glyma14g11896 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g11896

Feature Type:	gene_model
Chromosome:	Gm14
Start:	10464927
stop:	10466491
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g11896

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G32400	AT	Annotation by Michelle Graham. TAIR10: Actin-binding FH2/DRF autoregulatory protein \| chr3:13356995-13360572 REVERSE LENGTH=488	SoyBase	E_val: 8.00E-21	ISS
GO:0016043	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular component organization	SoyBase	N/A	ISS
GO:0030036	GO-bp	Annotation by Michelle Graham. GO Biological Process: actin cytoskeleton organization	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003779	GO-mf	Annotation by Michelle Graham. GO Molecular Function: actin binding	SoyBase	N/A	ISS
UniRef100_B9RNW2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RNW2_RICCO	SoyBase	E_val: 2.00E-25	ISS
UniRef100_UPI000233B9D9	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B9D9 related cluster n=1 Tax=unknown RepID=UPI000233B9D9	SoyBase	E_val: 2.00E-39	ISS

Expression Patterns of Glyma14g11896

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g11896 not represented in the dataset	Glyma14g11896 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g11896 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma14g11896

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g11896

Limit To All Plant Sequences

>Glyma14g11896.1   sequence type=CDS   gene model=Glyma14g11896   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACCAGGGTAGAAATGCAGATGCATTGGCTTTGTACTTTGGCGAAGATCCAGCACGTGTCCCATTTGAACAAGGTGTAAAGAGGAGTAAGGGAAGAACAAAAGGAAAAAAAATGCAAACACTATATTTGATTTCTATTTTGAACAACTGTTTATATGACATTTTTGGGGATTTGATTCTTTTCTTTTCTCTAATTGTATCTACTCTCCTCAACTTTGTGAGAATGTTCATAAAAGCGCTTGAAGAAAATTGCAAGCAGATTGAATTAGAAAAAAAGAAAGCAGATAAGGAAGCAGAAAGTGAGAAGTTGAAGCTAGCTGCTGCTAAAAAGGAGTCTGAACAGATGATAAGGACCACCATAAAGAGTGGGAATATTAAATGA

Predicted protein sequences of Glyma14g11896

Limit To All Plant Sequences

>Glyma14g11896.1   sequence type=predicted peptide   gene model=Glyma14g11896   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYQGRNADALALYFGEDPARVPFEQGVKRSKGRTKGKKMQTLYLISILNNCLYDIFGDLILFFSLIVSTLLNFVRMFIKALEENCKQIELEKKKADKEAESEKLKLAAAKKESEQMIRTTIKSGNIK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain