SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g11803

Feature Type:gene_model
Chromosome:Gm14
Start:10338547
stop:10338922
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g11803
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G61850AT Annotation by Michelle Graham. TAIR10: phospholipases;galactolipases | chr1:22856317-22862225 FORWARD LENGTH=1311 SoyBaseE_val: 2.00E-17ISS
GO:0006629GO-bp Annotation by Michelle Graham. GO Biological Process: lipid metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016926GO-bp Annotation by Michelle Graham. GO Biological Process: protein desumoylation SoyBaseN/AISS
GO:0050665GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004620GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipase activity SoyBaseN/AISS
GO:0047714GO-mf Annotation by Michelle Graham. GO Molecular Function: galactolipase activity SoyBaseN/AISS
UniRef100_G7JI15UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcium-independent phospholipase A2-gamma n=1 Tax=Medicago truncatula RepID=G7JI15_MEDTR SoyBaseE_val: 6.00E-25ISS
UniRef100_I1KNB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KNB6_SOYBN SoyBaseE_val: 8.00E-41ISS

Expression Patterns of Glyma14g11803
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g11803 not represented in the dataset
Glyma14g11803 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g11803 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g11803
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g11803
>Glyma14g11803.1   sequence type=CDS   gene model=Glyma14g11803   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGCACTGTCGATGTCGCAGGACACGGTCGTGGTTGAGTTGAGGCCGAGGGACGATGATGAGAGCGTGGTGGACTTGGGAATGAAGGTTGTTAAGCGAAGAGAGCCTCTCAGGGCGGTCACAATGGCCAAGGCTGTTGCCTCCGATCAGCAGAGCGACGGCATTGGTATTTTGATACGCTTGTTGCGCTCCGATTTGCCATCCTCGACGCCGCCAAATGTTGGAGATGTCGTCCTTGCCGGTTCCGGCCACCACTAG
Predicted protein sequences of Glyma14g11803
>Glyma14g11803.1   sequence type=predicted peptide   gene model=Glyma14g11803   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVALSMSQDTVVVELRPRDDDESVVDLGMKVVKRREPLRAVTMAKAVASDQQSDGIGILIRLLRSDLPSSTPPNVGDVVLAGSGHH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo