Glyma14g11730 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g11730

Feature Type:	gene_model
Chromosome:	Gm14
Start:	10271223
stop:	10276678
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g11730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G25080	AT	Annotation by Michelle Graham. TAIR10: Sas10/Utp3/C1D family \| chr5:8643782-8646306 FORWARD LENGTH=217	SoyBase	E_val: 8.00E-34	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG4835	KOG	DNA-binding protein C1D involved in regulation of double-strand break repair	JGI		ISS
PF04000	PFAM	Sas10/Utp3/C1D family	JGI		ISS
UniRef100_C6T2F3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2F3_SOYBN	SoyBase	E_val: 9.00E-128	ISS
UniRef100_G7J9T9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear nucleic acid-binding protein C1D n=1 Tax=Medicago truncatula RepID=G7J9T9_MEDTR	SoyBase	E_val: 2.00E-40	ISS

Expression Patterns of Glyma14g11730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g11730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g101700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g11730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g11730

Limit To All Plant Sequences

>Glyma14g11730.1   sequence type=CDS   gene model=Glyma14g11730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGAAAGGAAGAAGCGAAATGGATGGCGTAGAAGTACCTGAAGCCATGATAGATACTCTCAACCGTACTTTGGAGAGCCTTCAACAACTCGAGACACAGTTACCCCAATTTCTCTCTCTCTCCGACCCTGATTTTCTCGCTGAATTACCACTCGTTGAACGCGCTCACTCACTCTTCTCCCTCGCCAAACTCACCTCTACCCTCTTCTCATTGAAGTTGAGGTGTAGAGGTGTTAACCCAAATGGCCACCCTGTCAAATCCGAGCTTGACAAGATAAACGTGTTGCAGAAGAAACTGGAACGGCTTCCGCGGTTCACTGAAGCACAGGAGCAAGACACTAGGAACATAAGTGAAGAGGAGGAGCCAGAGATGAACTATCAGGAACGGACTAGTCAAAAGAGGAAGTATCCATCGTCTGAAGAACAGTTTGTTCAAATTGATGCTGTGGGATCCCTGGTTAAAGTAAAGGAGGAACATGTTGGTGATAATAATGGAAATATTAAGGAAGCAATAGTGATTGACATTTCAGATGATGATGAATGA

Predicted protein sequences of Glyma14g11730

Limit To All Plant Sequences

>Glyma14g11730.1   sequence type=predicted peptide   gene model=Glyma14g11730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKGRSEMDGVEVPEAMIDTLNRTLESLQQLETQLPQFLSLSDPDFLAELPLVERAHSLFSLAKLTSTLFSLKLRCRGVNPNGHPVKSELDKINVLQKKLERLPRFTEAQEQDTRNISEEEEPEMNYQERTSQKRKYPSSEEQFVQIDAVGSLVKVKEEHVGDNNGNIKEAIVIDISDDDE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain