Glyma14g11505 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g11505): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g11505): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g11505

Feature Type:	gene_model
Chromosome:	Gm14
Start:	10067048
stop:	10068453
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g11505

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G46430	AT	Annotation by Michelle Graham. TAIR10: cyclic nucleotide gated channel 3 \| chr2:19058472-19061273 FORWARD LENGTH=706	SoyBase	E_val: 2.00E-32	ISS
GO:0006811	GO-bp	Annotation by Michelle Graham. GO Biological Process: ion transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005216	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ion channel activity	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
GO:0030551	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cyclic nucleotide binding	SoyBase	N/A	ISS
PTHR10217	Panther	VOLTAGE AND LIGAND GATED POTASSIUM CHANNEL	JGI		ISS
PTHR10217:SF7	Panther	POTASSIUM CHANNEL PROTEIN EAG-RELATED	JGI		ISS
UniRef100_I1M970	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M970_SOYBN	SoyBase	E_val: 7.00E-44	ISS
UniRef100_Q8H6U3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cyclic nucleotide-gated channel A (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q8H6U3_PHAVU	SoyBase	E_val: 5.00E-31	ISS

Expression Patterns of Glyma14g11505

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g11505 not represented in the dataset	Glyma14g11505 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g11505 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g100500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g11505

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g11505

Limit To All Plant Sequences

>Glyma14g11505.1   sequence type=CDS   gene model=Glyma14g11505   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACGAGGAGGAGCTCGAAGCGGTGGCTTGCTCCGCTAGCTCCGACGATGATAATTCGCAGAATGAAGCCGCTGAAGACGACAACGAGGATAAACAGTTCTGTTGGGGAGATAATCTTTGCTATCTTCATTTCTGTCTTTGGATTGGTTCTATTTGCATCACTTATTGCAAACATGCAGAAATATCTACAATCTACCAGTGTGAGAGTTGAAGAGATGAGAGTCAAAAGGAGGGATGCAGAACAGTGGATGTCCCACCATATGCTACCAGATTTGCTGAAGGAAAGAATTAGAAGGTATGAGCAATACTTGTATGTGTGA

Predicted protein sequences of Glyma14g11505

Limit To All Plant Sequences

>Glyma14g11505.1   sequence type=predicted peptide   gene model=Glyma14g11505   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTRRSSKRWLAPLAPTMIIRRMKPLKTTTRINSSVGEIIFAIFISVFGLVLFASLIANMQKYLQSTSVRVEEMRVKRRDAEQWMSHHMLPDLLKERIRRYEQYLYV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain