Glyma14g11030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g11030

Feature Type:	gene_model
Chromosome:	Gm14
Start:	9314245
stop:	9318032
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g11030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26150	AT	Annotation by Michelle Graham. TAIR10: heat shock transcription factor A2 \| chr2:11135856-11137217 FORWARD LENGTH=345	SoyBase	E_val: 2.00E-122	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0009407	GO-bp	Annotation by Michelle Graham. GO Biological Process: toxin catabolic process	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0010286	GO-bp	Annotation by Michelle Graham. GO Biological Process: heat acclimation	SoyBase	N/A	ISS
GO:0034605	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to heat	SoyBase	N/A	ISS
GO:0034620	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to unfolded protein	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0071456	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to hypoxia	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG0627	KOG	Heat shock transcription factor	JGI		ISS
PTHR10015	Panther	HEAT SHOCK TRANSCRIPTION FACTOR	JGI		ISS
PTHR10015:SF7	Panther	HEAT SHOCK TRANSCRIPTION FACTOR	JGI		ISS
PF00447	PFAM	HSF-type DNA-binding	JGI		ISS
UniRef100_E7CQA1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Heat shock transcription factor A-2 n=1 Tax=Arachis hypogaea subsp. hypogaea RepID=E7CQA1_ARAHY	SoyBase	E_val: 4.00E-160	ISS
UniRef100_I1M939	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=3 Tax=Glycine max RepID=I1M939_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma14g11030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g11030

Paralog	Evidence	Comments
Glyma17g34540	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g11030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g096800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g11030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g11030

Limit To All Plant Sequences

>Glyma14g11030.1   sequence type=CDS   gene model=Glyma14g11030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACATGGAGAGAATTAGAGTGAAGGAGGAAGAAGCAGTGACATGTGGTGGTGGTTCATCATCATCATCATCTTCGTCTTCAAGCTTTTCTCCACAGCCTATGGAAGGGTTGCACGAGGTGGGTCCCCCTCCGTTTCTGAGCAAGATCTTTGACATGGTAGAAGATTCTTCCACGGACTCCATTGTGTCATGGAGCATGGCTCGCAACAGCTTTGTGGTGTGGGATTCTCACAAGTTTTCTGCTGACATTCTGCCTCGTTACTTCAAGCACGGCAATTTCTCCAGCTTCATTCGCCAGCTCAACGCCTATGGGTTTAGGAAAGTTGATCCTGATAGATGGGAATTTGCAAACGAAGGTTTTTTGGCAGGACAAAGGCACTTATTGAAGACCATTAAGAGAAGAAGAAATGTGTCACAGAGTTTGCAACAAAAAGGAGGAAGTGGAGCTTGTGTTGAAGTGGGGGAGTTTGGACTCGAAGGTGAGTTGGAGAGGTTGAAAAGAGACAGGAACATTTTGATGGCAGAAATTGTGAGATTGAGGCACCAACAACTGAACTCAAGGGAACAATTGAATTCCATGGAGACCAGATTGCAAGCCACTGAGAAGAAACAGCAGCAAATGATGAGTTTCCTTGCAAAAGCACTGAGTAACCCATCTTTCACGAAACAATTAGTCCAAAAGACCCCCCAAAGCAGAGAAGTGTTGGGTGTTGAAATCAATAGGAAAAGGAGACTGACTGCTAGTCCAAGTGTTGAGAACTTGCAACAAGATGATCAAGATTTGGCAACTTTGGATTATCCAAGCCATGATCGAGATTTGGCAACTATGGAGACTGATATGGACACTTTTTTCTCACCGGCTTATGATAATGAACTTAGCAGTGAAACCAATGAGCCTGCATCAATTTCGGTTGAGGATACAATCTTGGAGGACTTTCTCAACAAAGACTTGGTTACTTGGAATCCGGAGGATGAAGTTATAATTGGGGATAGTTCCCAAGTCGATGTGCCGGTGGAGGATTTGGTTGCAAACCCTGATGATTGGAGTGAGCAATTGCAGGACCTTGTGGATCATATGGACTATCTAGGCTAA

Predicted protein sequences of Glyma14g11030

Limit To All Plant Sequences

>Glyma14g11030.1   sequence type=predicted peptide   gene model=Glyma14g11030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYMERIRVKEEEAVTCGGGSSSSSSSSSSFSPQPMEGLHEVGPPPFLSKIFDMVEDSSTDSIVSWSMARNSFVVWDSHKFSADILPRYFKHGNFSSFIRQLNAYGFRKVDPDRWEFANEGFLAGQRHLLKTIKRRRNVSQSLQQKGGSGACVEVGEFGLEGELERLKRDRNILMAEIVRLRHQQLNSREQLNSMETRLQATEKKQQQMMSFLAKALSNPSFTKQLVQKTPQSREVLGVEINRKRRLTASPSVENLQQDDQDLATLDYPSHDRDLATMETDMDTFFSPAYDNELSSETNEPASISVEDTILEDFLNKDLVTWNPEDEVIIGDSSQVDVPVEDLVANPDDWSEQLQDLVDHMDYLG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain