SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g10646

Feature Type:gene_model
Chromosome:Gm14
Start:8844088
stop:8846397
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g10646
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G26010AT Annotation by Michelle Graham. TAIR10: Protein phosphatase 2C family protein | chr5:9085512-9087372 REVERSE LENGTH=331 SoyBaseE_val: 3.00E-14ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006826GO-bp Annotation by Michelle Graham. GO Biological Process: iron ion transport SoyBaseN/AISS
GO:0010106GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004722GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity SoyBaseN/AISS
UniRef100_B9RRV1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein phosphatase-2c, putative n=1 Tax=Ricinus communis RepID=B9RRV1_RICCO SoyBaseE_val: 3.00E-20ISS
UniRef100_I1M901UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M901_SOYBN SoyBaseE_val: 3.00E-68ISS

Expression Patterns of Glyma14g10646
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g10646 not represented in the dataset
Glyma14g10646 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g10646
ParalogEvidenceComments
Glyma17g34880 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g10646 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g10646
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g10646
>Glyma14g10646.1   sequence type=CDS   gene model=Glyma14g10646   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTATATGCATATCCGTTGCAGAAGGAGTTAACGATGATAATGTGACAATATTTCAAGCAAGAAAGGTCCCGAATGAGAGTCAGAGACTTTGCTCTGTTTACTCCCAACAGGGTAGCAAAGGACTCAACCAAGATGCTGCCTCTGTTCACGAGGGTTATGGGATGGAAGATGGAACATTTTTTGGAGTTTATGATGAGCATGGAGGGAATGGACACAAAGTGAGCAAAATAGTAAGCAGTCGTTTATCTTCCCTCATACTGGACCAAAAGAATGTTCTTGAAAAGATTGATGCAATAGAGAATGGTTAG
Predicted protein sequences of Glyma14g10646
>Glyma14g10646.1   sequence type=predicted peptide   gene model=Glyma14g10646   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGICISVAEGVNDDNVTIFQARKVPNESQRLCSVYSQQGSKGLNQDAASVHEGYGMEDGTFFGVYDEHGGNGHKVSKIVSSRLSSLILDQKNVLEKIDAIENG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo