Glyma14g09990 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g09990

Feature Type:	gene_model
Chromosome:	Gm14
Start:	8075576
stop:	8076653
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g09990

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G49780	AT	Annotation by Michelle Graham. TAIR10: phytosulfokine 4 precursor \| chr3:18465750-18466254 FORWARD LENGTH=79	SoyBase	E_val: 3.00E-17	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0009887	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ morphogenesis	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0031012	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix	SoyBase	N/A	ISS
GO:0008083	GO-mf	Annotation by Michelle Graham. GO Molecular Function: growth factor activity	SoyBase	N/A	ISS
PF06404	PFAM	Phytosulfokine precursor protein (PSK)	JGI		ISS
UniRef100_B9SH34	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phytosulfokines, putative n=1 Tax=Ricinus communis RepID=B9SH34_RICCO	SoyBase	E_val: 6.00E-21	ISS
UniRef100_Q7PCB0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative phytosulfokine peptide n=1 Tax=Glycine max RepID=Q7PCB0_SOYBN	SoyBase	E_val: 3.00E-50	ISS

Expression Patterns of Glyma14g09990

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g09990

Paralog	Evidence	Comments
Glyma17g35165	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g09990 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.U029600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g09990

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g09990

Limit To All Plant Sequences

>Glyma14g09990.1   sequence type=CDS   gene model=Glyma14g09990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAAAGTGGTCACACTCTTCACTTTGGCTCTTCTATTAAGCTTCAATTTAATCCATGCCTCTCGTCCTAATCCTTCACTTAACGTTGTCTCTTCTTCGCATGAGGATGTTGCAGCTACAAAGGAAGAGATAGATGAAGAGAGTTGTGAAGAAGGCACAGAAGAATGTTTGATAAGAAGGACGCTAGCTGCACATGTCGATTATATCTACACTCAAAAGCATAAACCCAAACCTTAA

Predicted protein sequences of Glyma14g09990

Limit To All Plant Sequences

>Glyma14g09990.1   sequence type=predicted peptide   gene model=Glyma14g09990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKVVTLFTLALLLSFNLIHASRPNPSLNVVSSSHEDVAATKEEIDEESCEEGTEECLIRRTLAAHVDYIYTQKHKPKP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain