SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g09850

Feature Type:gene_model
Chromosome:Gm14
Start:7916257
stop:7918903
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g09850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63905AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: cellular_component unknown; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 12 growth stages; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr5:25571055-25571503 REVERSE LENGTH=76 SoyBaseE_val: 4.00E-13ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1M8U0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M8U0_SOYBN SoyBaseE_val: 2.00E-45ISS
UniRef100_Q2QQ14UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q2QQ14_ORYSJ SoyBaseE_val: 2.00E-07ISS

Expression Patterns of Glyma14g09850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g09850
ParalogEvidenceComments
Glyma17g35320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g09850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.U031100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g09850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g09850
>Glyma14g09850.1   sequence type=CDS   gene model=Glyma14g09850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCTTTGCTTTGGTTGCTTCGGCGTAGACAAACGCATGAGCAAGGAAGAAGAGAGATTGGCCTCTGAAGAAGCGCGTGCCAAAGCTGCTGAAGCCGCACAGAAAAGGCAAGAGCAATTTGAGAATTCTGCAGCAGGACGAGCTGCTCGTGCACAGCAACAAGCAATGGCAAAGCAATCTGCAAATACCAACAAAGGCGAACCAGTTCTAAAGTGGCAAATGAGTTGA
Predicted protein sequences of Glyma14g09850
>Glyma14g09850.1   sequence type=predicted peptide   gene model=Glyma14g09850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLCFGCFGVDKRMSKEEERLASEEARAKAAEAAQKRQEQFENSAAGRAARAQQQAMAKQSANTNKGEPVLKWQMS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo