Report for Sequence Feature Glyma14g09710
Feature Type: gene_model
Chromosome: Gm14
Start: 7773468
stop: 7775693
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma14g09710
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G01075 AT
Annotation by Michelle Graham. TAIR10: Glycosyl hydrolase family 35 protein | chr5:27095-27423 REVERSE LENGTH=81
SoyBase E_val: 3.00E-10 ISS
GO:0005975 GO-bp
Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process
SoyBase N/A ISS
GO:0004553 GO-mf
Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds
SoyBase N/A ISS
UniRef100_I1M8S7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M8S7_SOYBN
SoyBase E_val: 1.00E-82 ISS
Expression Patterns of Glyma14g09710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma14g09710
Paralog Evidence Comments
Glyma17g35460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma14g09710 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.14g087800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma14g09710
Coding sequences of Glyma14g09710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g09710.1 sequence type=CDS gene model=Glyma14g09710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGAAGGTTTCTGGCTTCTTTGTTTTGCTCTTGGTAGTTGGAGCAACTCTGTCGTTCCTTAACTTCTTAAGTCCCACTTGTGCCTCATGGTTTTCTGATTTGATTGCTACCAACTGTGGTGATAAAGCTACACTGATTGCAGTAAGCAGGAAACTTAAGGAAAGTGACAGTAGTACTATTAAAAGCAGATCTAACAATAAGGGTGATATAGGTCAGGTGACTCTGAATGATTACAATCCCATTGATCCAGTGCCAAGTTCATCAAAGGCGTCTATTAATCCAGGACCTATTGAGCATGGAACCCCTCTTAATCCATATATTATCCCAAAACCTTCACCCCCTAATCATCCTAAGCCTGGAGATTCTAACTAA
Predicted protein sequences of Glyma14g09710
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g09710.1 sequence type=predicted peptide gene model=Glyma14g09710 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKKVSGFFVLLLVVGATLSFLNFLSPTCASWFSDLIATNCGDKATLIAVSRKLKESDSSTIKSRSNNKGDIGQVTLNDYNPIDPVPSSSKASINPGPIEHGTPLNPYIIPKPSPPNHPKPGDSN*