Glyma14g09600 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g09600

Feature Type:	gene_model
Chromosome:	Gm14
Start:	7676648
stop:	7677424
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g09600

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_E9L557	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CLE11 protein n=2 Tax=Glycine max RepID=E9L557_SOYBN	SoyBase	E_val: 4.00E-54	ISS
UniRef100_E9L557	UniRef	Annotation by Michelle Graham. Best UniRef hit: CLE11 protein n=2 Tax=Glycine max RepID=E9L557_SOYBN	SoyBase	E_val: 4.00E-54	ISS

Expression Patterns of Glyma14g09600

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g09600

Paralog	Evidence	Comments
Glyma17g35570	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g09600 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g087000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g09600

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g09600

Limit To All Plant Sequences

>Glyma14g09600.2   sequence type=CDS   gene model=Glyma14g09600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACTTTCACCAGTGCTCTCTTGTTGGGGGGTTGAAGAGGTTCATGGTTTTTGTTCTGCTCACATTCATAGTCTGTGGTGAAAAAGAAGAGCCTTCAGTTGTTGTTGATCAGCACTACCAGCCACACAATATGACAGAGAAACAAGAAAAGCCGAATCAACACCTCAATCCACGTTACCCTTTTGGTGTTTACTTCTCACAGAAGAGAAAGGTTCCCAATGCATCAGATCCTCTCCACAACCGTTGA

Predicted protein sequences of Glyma14g09600

Limit To All Plant Sequences

>Glyma14g09600.2   sequence type=predicted peptide   gene model=Glyma14g09600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHFHQCSLVGGLKRFMVFVLLTFIVCGEKEEPSVVVDQHYQPHNMTEKQEKPNQHLNPRYPFGVYFSQKRKVPNASDPLHNR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain