Report for Sequence Feature Glyma14g09500
Feature Type: gene_model
Chromosome: Gm14
Start: 7573880
stop: 7575978
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma14g09500
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G34160 AT
Annotation by Michelle Graham. TAIR10: CYCLIN D3;1 | chr4:16357903-16359304 FORWARD LENGTH=376
SoyBase E_val: 7.00E-64 ISS
GO:0000080 GO-bp
Annotation by Michelle Graham. GO Biological Process: G1 phase of mitotic cell cycle
SoyBase N/A ISS
GO:0000082 GO-bp
Annotation by Michelle Graham. GO Biological Process: G1/S transition of mitotic cell cycle
SoyBase N/A ISS
GO:0000087 GO-bp
Annotation by Michelle Graham. GO Biological Process: M phase of mitotic cell cycle
SoyBase N/A ISS
GO:0000280 GO-bp
Annotation by Michelle Graham. GO Biological Process: nuclear division
SoyBase N/A ISS
GO:0000911 GO-bp
Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation
SoyBase N/A ISS
GO:0006275 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication
SoyBase N/A ISS
GO:0009735 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus
SoyBase N/A ISS
GO:0009741 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus
SoyBase N/A ISS
GO:0009744 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus
SoyBase N/A ISS
GO:0010075 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth
SoyBase N/A ISS
GO:0010103 GO-bp
Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis
SoyBase N/A ISS
GO:0010389 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle
SoyBase N/A ISS
GO:0010583 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone
SoyBase N/A ISS
GO:0042023 GO-bp
Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication
SoyBase N/A ISS
GO:0042127 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation
SoyBase N/A ISS
GO:0048316 GO-bp
Annotation by Michelle Graham. GO Biological Process: seed development
SoyBase N/A ISS
GO:0051225 GO-bp
Annotation by Michelle Graham. GO Biological Process: spindle assembly
SoyBase N/A ISS
GO:0051322 GO-bp
Annotation by Michelle Graham. GO Biological Process: anaphase
SoyBase N/A ISS
GO:0051329 GO-bp
Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle
SoyBase N/A ISS
GO:0051726 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
GO:0016538 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase regulator activity
SoyBase N/A ISS
PTHR10177 Panther
CYCLINS
JGI ISS
PTHR10177:SF76 Panther
CYCLIN-D
JGI ISS
PF00134 PFAM
Cyclin, N-terminal domain
JGI ISS
UniRef100_B9R768 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cyclin d, putative n=1 Tax=Ricinus communis RepID=B9R768_RICCO
SoyBase E_val: 6.00E-89 ISS
UniRef100_UPI000233B6E6 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233B6E6 related cluster n=1 Tax=unknown RepID=UPI000233B6E6
SoyBase E_val: 1.00E-177 ISS
Expression Patterns of Glyma14g09500
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma14g09500
Paralog Evidence Comments
Glyma17g35671 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma14g09500 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.14g086200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma14g09500
Coding sequences of Glyma14g09500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma14g09500.2 sequence type=CDS gene model=Glyma14g09500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCCACTAGACCACCACCTCTTCTTAGAAGAAATTAAAATGGCACATCGTTACCCAAAACCCCTCTTAGACACCCTCTACTGCTTAAAAGACCATATTCATTGGGAGGAAGAACAAGTAGAAGATGATGAGTACAGTAGTAGCACAACCACAACAATCACAAACACAAACACAGACACCTCCTCTGTGGTCTTTTTAGAACACGACCTCTTCTGGGACCGCGAGGAGCTATCTTCTCTTCTCGCCAAAGAACACCAAAACCAACTCTCGAATACTCTCCAAAAAAACCTCGTTTTAGCCTCATCTCGACAAGAAGCAGTGGAGTGGATTCTGAAAGTGAATGCCCATTATTCCTTTTCTACCCTCACCGCGGTTCTCGCTGTTAACTACCTCGATAGGTTCCTCTTCAGCTTCAGATTCCAGAACGACAGCAACAACAATCCTTGGCTCACACAACTAGCCGCAGTAGCTTGTCTCTCTCTCGCTGCCAAGGTTGAAGAGACCCACGTGCCCCTCTTTGTAGACCTCCAAGTGGAGGAGAGTAAGTACTTGTTTGAAGCGAAAGCGGTTAATAGAATGGAAATCTTAGTGCTTTCAGCACTTGGATGGCAGATGAACCCTGTAACACCTCTCTCGTTTCTTGATTACATCACAAGGAAACTTGGGTTAAAGGGTTATCTGTGTTTGGAGTTTCTTAGAAGGTGTGAAACCGTTCTTCTCTCTGTTTTCGCAGGAGAAGGTGGAAGAATGCTACAAGCTGATGATGGAGGTTGTGTCTGGGTACCGATGAGGAGGGAAAACGATCCAAGTTGA
Predicted protein sequences of Glyma14g09500
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma14g09500.2 sequence type=predicted peptide gene model=Glyma14g09500 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MPLDHHLFLEEIKMAHRYPKPLLDTLYCLKDHIHWEEEQVEDDEYSSSTTTTITNTNTDTSSVVFLEHDLFWDREELSSLLAKEHQNQLSNTLQKNLVLASSRQEAVEWILKVNAHYSFSTLTAVLAVNYLDRFLFSFRFQNDSNNNPWLTQLAAVACLSLAAKVEETHVPLFVDLQVEESKYLFEAKAVNRMEILVLSALGWQMNPVTPLSFLDYITRKLGLKGYLCLEFLRRCETVLLSVFAGEGGRMLQADDGGCVWVPMRRENDPS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
