SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g09500

Feature Type:gene_model
Chromosome:Gm14
Start:7573880
stop:7575978
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34160AT Annotation by Michelle Graham. TAIR10: CYCLIN D3;1 | chr4:16357903-16359304 FORWARD LENGTH=376 SoyBaseE_val: 7.00E-64ISS
GO:0000080GO-bp Annotation by Michelle Graham. GO Biological Process: G1 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000082GO-bp Annotation by Michelle Graham. GO Biological Process: G1/S transition of mitotic cell cycle SoyBaseN/AISS
GO:0000087GO-bp Annotation by Michelle Graham. GO Biological Process: M phase of mitotic cell cycle SoyBaseN/AISS
GO:0000280GO-bp Annotation by Michelle Graham. GO Biological Process: nuclear division SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0009735GO-bp Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus SoyBaseN/AISS
GO:0009741GO-bp Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0010103GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal complex morphogenesis SoyBaseN/AISS
GO:0010389GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of G2/M transition of mitotic cell cycle SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042127GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051329GO-bp Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0016538GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase regulator activity SoyBaseN/AISS
PTHR10177Panther CYCLINS JGI ISS
PTHR10177:SF76Panther CYCLIN-D JGI ISS
PF00134PFAM Cyclin, N-terminal domain JGI ISS
UniRef100_B9R768UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cyclin d, putative n=1 Tax=Ricinus communis RepID=B9R768_RICCO SoyBaseE_val: 6.00E-89ISS
UniRef100_UPI000233B6E6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B6E6 related cluster n=1 Tax=unknown RepID=UPI000233B6E6 SoyBaseE_val: 1.00E-177ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g35671 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g086200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g09500.2   sequence type=CDS   gene model=Glyma14g09500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCACTAGACCACCACCTCTTCTTAGAAGAAATTAAAATGGCACATCGTTACCCAAAACCCCTCTTAGACACCCTCTACTGCTTAAAAGACCATATTCATTGGGAGGAAGAACAAGTAGAAGATGATGAGTACAGTAGTAGCACAACCACAACAATCACAAACACAAACACAGACACCTCCTCTGTGGTCTTTTTAGAACACGACCTCTTCTGGGACCGCGAGGAGCTATCTTCTCTTCTCGCCAAAGAACACCAAAACCAACTCTCGAATACTCTCCAAAAAAACCTCGTTTTAGCCTCATCTCGACAAGAAGCAGTGGAGTGGATTCTGAAAGTGAATGCCCATTATTCCTTTTCTACCCTCACCGCGGTTCTCGCTGTTAACTACCTCGATAGGTTCCTCTTCAGCTTCAGATTCCAGAACGACAGCAACAACAATCCTTGGCTCACACAACTAGCCGCAGTAGCTTGTCTCTCTCTCGCTGCCAAGGTTGAAGAGACCCACGTGCCCCTCTTTGTAGACCTCCAAGTGGAGGAGAGTAAGTACTTGTTTGAAGCGAAAGCGGTTAATAGAATGGAAATCTTAGTGCTTTCAGCACTTGGATGGCAGATGAACCCTGTAACACCTCTCTCGTTTCTTGATTACATCACAAGGAAACTTGGGTTAAAGGGTTATCTGTGTTTGGAGTTTCTTAGAAGGTGTGAAACCGTTCTTCTCTCTGTTTTCGCAGGAGAAGGTGGAAGAATGCTACAAGCTGATGATGGAGGTTGTGTCTGGGTACCGATGAGGAGGGAAAACGATCCAAGTTGA

>Glyma14g09500.2   sequence type=predicted peptide   gene model=Glyma14g09500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPLDHHLFLEEIKMAHRYPKPLLDTLYCLKDHIHWEEEQVEDDEYSSSTTTTITNTNTDTSSVVFLEHDLFWDREELSSLLAKEHQNQLSNTLQKNLVLASSRQEAVEWILKVNAHYSFSTLTAVLAVNYLDRFLFSFRFQNDSNNNPWLTQLAAVACLSLAAKVEETHVPLFVDLQVEESKYLFEAKAVNRMEILVLSALGWQMNPVTPLSFLDYITRKLGLKGYLCLEFLRRCETVLLSVFAGEGGRMLQADDGGCVWVPMRRENDPS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo