Glyma14g09430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g09430

Feature Type:	gene_model
Chromosome:	Gm14
Start:	7491828
stop:	7492262
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g09430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18210	AT	Annotation by Michelle Graham. TAIR10: Calcium-binding EF-hand family protein \| chr1:6268273-6268785 REVERSE LENGTH=170	SoyBase	E_val: 2.00E-37	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005509	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calcium ion binding	SoyBase	N/A	ISS
KOG0027	KOG	Calmodulin and related proteins (EF-Hand superfamily)	JGI		ISS
PTHR10891	Panther	CALMODULIN	JGI		ISS
PTHR10891:SF39	Panther	EF-HAND CALCIUM BINDING PROTEIN	JGI		ISS
PF00036	PFAM	EF hand	JGI		ISS
UniRef100_I1M8Q4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M8Q4_SOYBN	SoyBase	E_val: 6.00E-98	ISS
UniRef100_Q93YA8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Calcium binding protein n=1 Tax=Sesbania rostrata RepID=Q93YA8_SESRO	SoyBase	E_val: 1.00E-46	ISS

Expression Patterns of Glyma14g09430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g09430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g085700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g09430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g09430

Limit To All Plant Sequences

>Glyma14g09430.1   sequence type=CDS   gene model=Glyma14g09430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACGAACTCGAGACAATCTTCAACCGCTTCGACACCAACGGTAACGGCAAGATCTCCGCTGACGAGCTCGACAGCGTGCTCCGGTCGCTCGGATCCGACGTCTCTCCAGAGGACCTCCGCCATGTCATGGAAGACCTCGACACTGACCGCGACGACTTCATCAACCTCATGGAGTTCGTCGCCTTCTGCCGCTCCGATGCCTCCATCGACGGTGGATCCAGCGAGTTCCGTGATGCCTTCGATCTCTACAACCGCGACAAAAATGGCCTCATCTCTACCGCGGAGCTCCACCTCGCGCTCAATAGCCTCGACCTCAACTGTTTCGTCGATGAATGCCGTGTCACGAATCGTTGTGTCAACTTCGAGGAGTTCAAGACGATGATGACGACCTCCAAGAATCGCGGCGACGCCACGAATGACTCCGTCCATTAG

Predicted protein sequences of Glyma14g09430

Limit To All Plant Sequences

>Glyma14g09430.1   sequence type=predicted peptide   gene model=Glyma14g09430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNELETIFNRFDTNGNGKISADELDSVLRSLGSDVSPEDLRHVMEDLDTDRDDFINLMEFVAFCRSDASIDGGSSEFRDAFDLYNRDKNGLISTAELHLALNSLDLNCFVDECRVTNRCVNFEEFKTMMTTSKNRGDATNDSVH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain