SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma14g09320

Feature Type:gene_model
Chromosome:Gm14
Start:7346033
stop:7347516
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G46768AT Annotation by Michelle Graham. TAIR10: related to AP2 1 | chr1:17266046-17266507 REVERSE LENGTH=153 SoyBaseE_val: 5.00E-50ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_Q7Y0Y9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dehydration responsive element binding protein n=1 Tax=Glycine max RepID=Q7Y0Y9_SOYBN SoyBaseE_val: 6.00E-128ISS
UniRef100_Q7Y0Y9UniRef Annotation by Michelle Graham. Best UniRef hit: Dehydration responsive element binding protein n=1 Tax=Glycine max RepID=Q7Y0Y9_SOYBN SoyBaseE_val: 6.00E-128ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma17g35860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g084700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma14g09320.1   sequence type=CDS   gene model=Glyma14g09320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGACAGGGATCACTGTTGTTCCAACAATTCAACGATGATCACAACAACAAAGAAAAGAACGGGTAGAAGAAGTCCAACATCGGATAAGCTCAAGAATCAACACCGCGAGAAGCAGTCGATGAAACCTTACCGTGGAATAAGGATGCGGAAGTGGGGGAAGTGGGTGGCGGAGATCAGAGAACCCAACAAAAGGTCGAGGATATGGTTGGGTTCTTACACGACACCCGTGGCCGCCGCACGTGCCTACGACACCGCTGTCTTTTACCTCCGGGGTCCCACCGCGCGCCTTAACTTCCCCGAACTCTTGTTCCAGGACGACGACCAGGAGGGCAGTGATTCGGTGCAGCACGGCGCAGCAGGGAACATGTCCGCTGATTCCATTCGCCGAAAAGCCACGCAAGTCGGCGCCAGAGTCGACGCTCTCCAAACCGCGCTTCACCACCACGCGCCAAGTACCAACTCTCTCAATCTCAAGCCCGACTTGAACGAGTTTCCAAAACTCGAAGAGCTTCAAGATTGA

>Glyma14g09320.1   sequence type=predicted peptide   gene model=Glyma14g09320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDRDHCCSNNSTMITTTKKRTGRRSPTSDKLKNQHREKQSMKPYRGIRMRKWGKWVAEIREPNKRSRIWLGSYTTPVAAARAYDTAVFYLRGPTARLNFPELLFQDDDQEGSDSVQHGAAGNMSADSIRRKATQVGARVDALQTALHHHAPSTNSLNLKPDLNEFPKLEELQD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo