SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g09091

Feature Type:gene_model
Chromosome:Gm14
Start:7073434
stop:7075023
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g09091
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G25000AT Annotation by Michelle Graham. TAIR10: alpha-amylase-like | chr4:12852109-12853825 REVERSE LENGTH=423 SoyBaseE_val: 4.00E-27ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004556GO-mf Annotation by Michelle Graham. GO Molecular Function: alpha-amylase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PF07821PFAM Alpha-amylase C-terminal beta-sheet domain JGI ISS
UniRef100_G7I3K7UniRef Annotation by Michelle Graham. Best UniRef hit: Alpha amylase n=1 Tax=Medicago truncatula RepID=G7I3K7_MEDTR SoyBaseE_val: 2.00E-37ISS
UniRef100_G7I3K7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alpha amylase n=1 Tax=Medicago truncatula RepID=G7I3K7_MEDTR SoyBaseE_val: 2.00E-37ISS

Expression Patterns of Glyma14g09091
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g09091 not represented in the dataset
Glyma14g09091 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma14g09091 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g09091
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g09091
>Glyma14g09091.1   sequence type=CDS   gene model=Glyma14g09091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGAGTTTCTTACTTCACTCTGTTTCCTATTCCTTTGCATTTTTCTTTTCCCTTCTTTCTCTTCTTCCGCCATACTGTTTCAGGGGTTCAACTGGGCATCAAGTGAAAAAGCAGGAGAATGGTACAACTTTATGAAGACCTTGGTCCCTGACATAGCTGATTCTGGAGTTGACTATTTCTATGATCCCTACATCGAATGGGGGCTAAAGGAACCGATAAAGAAAGTGACAGAAATAAGGAAGAGAAATGGAGTTACGGCCACAAGCAGAGTAAATATTCTGGCAGCTGAGGCTGATCTCTACATGGCTGAAATTGACAACAAGATCATTGTCAAGATTGGACCCAAAATGGATCTTGTCAACCTTCTTCCACCAAATGTTCAGGTTGCTACCAGTGGACAAGACTACGCTGTGTGGAAGAGAAAGTGA
Predicted protein sequences of Glyma14g09091
>Glyma14g09091.1   sequence type=predicted peptide   gene model=Glyma14g09091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDEFLTSLCFLFLCIFLFPSFSSSAILFQGFNWASSEKAGEWYNFMKTLVPDIADSGVDYFYDPYIEWGLKEPIKKVTEIRKRNGVTATSRVNILAAEADLYMAEIDNKIIVKIGPKMDLVNLLPPNVQVATSGQDYAVWKRK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo