|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G11960 | AT | Annotation by Michelle Graham. TAIR10: Cleavage and polyadenylation specificity factor (CPSF) A subunit protein | chr3:3786431-3793160 FORWARD LENGTH=1379 | SoyBase | E_val: 8.00E-14 | ISS |
GO:0000956 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process | SoyBase | N/A | ISS |
GO:0006486 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein glycosylation | SoyBase | N/A | ISS |
GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
GO:0009755 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway | SoyBase | N/A | ISS |
GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
GO:0048825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cotyledon development | SoyBase | N/A | ISS |
GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
UniRef100_G8A1A5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Pre-mRNA-splicing factor rse1 n=2 Tax=Medicago truncatula RepID=G8A1A5_MEDTR | SoyBase | E_val: 2.00E-15 | ISS |
UniRef100_G8A1A5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-splicing factor rse1 n=2 Tax=Medicago truncatula RepID=G8A1A5_MEDTR | SoyBase | E_val: 2.00E-15 | ISS |
Glyma14g08748 not represented in the dataset |
Glyma14g08748 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g08748.1 sequence type=CDS gene model=Glyma14g08748 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCCACAAGAGACTTAACATGTGGAAGTTTGGTTTAAAGGGAACTCTAAAGGAGGTCCTGTGTCACAATGAAAGTCGGATGTTGCTTGTATTGAGGACTGGACTAAATCATGATGGTGTTGTATGTTTGTCAGACATATGTTGTTGTGTGAATCCTCTAAGCTGTTCAATACTGTCGTCTTTTGAACTTAATGGAAAAGGAAGATGCATGGAATTAGTTAAGTTTGGAGGTGTTTGTGATTAG
>Glyma14g08748.1 sequence type=predicted peptide gene model=Glyma14g08748 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAHKRLNMWKFGLKGTLKEVLCHNESRMLLVLRTGLNHDGVVCLSDICCCVNPLSCSILSSFELNGKGRCMELVKFGGVCD*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||