SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g08520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g08520): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g08520

Feature Type:gene_model
Chromosome:Gm14
Start:6531638
stop:6542747
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g08520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47550AT Annotation by Michelle Graham. TAIR10: exocyst complex component sec3A | chr1:17457171-17463896 FORWARD LENGTH=888 SoyBaseE_val: 3.00E-95ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0000145GO-cc Annotation by Michelle Graham. GO Cellular Compartment: exocyst SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
PTHR16092Panther SEC3/SYNTAXIN-RELATED JGI ISS
PTHR16092:SF13Panther SUBFAMILY NOT NAMED JGI ISS
PF09763PFAM Exocyst complex component Sec3 JGI ISS
UniRef100_B9R7N2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Exocyst complex component sec3, putative n=1 Tax=Ricinus communis RepID=B9R7N2_RICCO SoyBaseE_val: 8.00E-97ISS
UniRef100_I1M8H2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M8H2_SOYBN SoyBaseE_val: 1.00E-110ISS

Expression Patterns of Glyma14g08520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g08520 not represented in the dataset
Glyma14g08520 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g08520
ParalogEvidenceComments
Glyma17g36540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g08520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma14g08520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g08520
>Glyma14g08520.2   sequence type=CDS   gene model=Glyma14g08520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGAGGTGTTGCAAGGGCTTGATGCTGCAACCAGTTGTGTGGAAGATATGGATGAATGGTTAAGCATATTCAATGTAAAACTCCGGCACATGAGGGAGGATATTGCATCAATAGAAACCCGCAATAACAACCTGGAAATGCAATCAGTAAATAACAAATCTCTCATTGAAGAGCTTGATAAGCTTCTTGAGCGATTGCGTGTCCCTTCTGAGTATGCCACAAATTTGACTGGAGGTTCATTTGATGAAGCTCGAATGCTTCAAAATGTAGAAGCATGTGAATGGTTGACCAGTGCCTTGCGTGGTCTTGGAGTGCCTAATCTAGATCCTAGTTATGCAAACATGAGAACTGTTAAAGAGAAGCGTGCAGAACTTGAAAAATTAAAATCTACTTTTGTCAGGAGAGCCTCTGAATTCTTGAGAAATTATTTTGCTAGTTTGGTGGACCTCATGATAAGTGATAAAAGTTACTTTTCTCAGCGGGGGCAGTTAAAAGAGGCCTGA
Predicted protein sequences of Glyma14g08520
>Glyma14g08520.2   sequence type=predicted peptide   gene model=Glyma14g08520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDEVLQGLDAATSCVEDMDEWLSIFNVKLRHMREDIASIETRNNNLEMQSVNNKSLIEELDKLLERLRVPSEYATNLTGGSFDEARMLQNVEACEWLTSALRGLGVPNLDPSYANMRTVKEKRAELEKLKSTFVRRASEFLRNYFASLVDLMISDKSYFSQRGQLKEA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo