SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g07560

Feature Type:gene_model
Chromosome:Gm14
Start:5711153
stop:5714535
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g07560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G37820AT Annotation by Michelle Graham. TAIR10: NOD26-like intrinsic protein 4;2 | chr5:15050261-15051542 FORWARD LENGTH=283 SoyBaseE_val: 1.00E-110ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0015250GO-mf Annotation by Michelle Graham. GO Molecular Function: water channel activity SoyBaseN/AISS
KOG0223 KOG Aquaporin (major intrinsic protein family) JGI ISS
PTHR19139Panther AQUAPORIN TRANSPORTER JGI ISS
PTHR19139:SF22Panther gb def: glycerol uptake facilitator protein [mycoplasma pulmonis] JGI ISS
PF00230PFAM Major intrinsic protein JGI ISS
UniRef100_G7KBN5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aquaporin MIP family NIP subfamily n=1 Tax=Medicago truncatula RepID=G7KBN5_MEDTR SoyBaseE_val: 8.00E-134ISS
UniRef100_I1M865UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1M865_SOYBN SoyBaseE_val: 1.00E-150ISS

Expression Patterns of Glyma14g07560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g07560
ParalogEvidenceComments
Glyma02g41400 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g07560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g069500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g07560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g07560
>Glyma14g07560.2   sequence type=CDS   gene model=Glyma14g07560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGCCAAATCTGAAGGCATCCAAGAAGAAATGCCAAGTATGGAAGAGGGTGTTTCTTCCCCTAGCCCTTCCAGAACCTGTAACGTATCACATAACTGTTGTTCAAACCATGTTGTAGCCCTCGCACAGAAGGTTTTCGCAGAAGTTATTGGTACATATTTTGTGGTATTTGCCGGTTGTGGCTCTGTGGCAGTGAATAAGATCTATGGCTCAGTCACATTTCCAGGGGTTTGTGTCACATGGGGGCTGATTGTAATGGTCATGATTTACTCTCTTCGTCATATCTCTGGAGCTCACTTCAATCCTGCAGTCACCATTACTTTGGCCATCTTTCGCCGCTTCTCATATAAACAGGTGCCACTCTACATTTTTGCTCAGTTGCTGGGGTCGATCCTTGCTAGTGGCACATTAGCCCTAATGTTGGATGTAACGCCTAAAGCTTATTTTGGAACGGTACCAGTTGGATCCAATGGCCAGTCTTTAGTTGCTGAAGTCATCATCACTTTTCTTTTGATGTTTGTTATATCTGCTGTTTCTACAGATGACAAAGCGGTGGGTGACTTTGCAGGAGTTGCAGTTGGGATGACTATAATGTTGAATGTCTTCATTGCCGGGCCTGTATCAGGGGCTTCCATGAACCCTGCAAGAAGTATTGGTCCGGCACTTATCAAACATGTTTACCAAGGGTTATGGATATACGTAGTTGGTCCAATTGTTGGATCCATAGCTGGAGCACTTGCCTATAATTTTCTTAGATCCCCATACAAGCCACCATCAGAATAA
Predicted protein sequences of Glyma14g07560
>Glyma14g07560.2   sequence type=predicted peptide   gene model=Glyma14g07560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAAKSEGIQEEMPSMEEGVSSPSPSRTCNVSHNCCSNHVVALAQKVFAEVIGTYFVVFAGCGSVAVNKIYGSVTFPGVCVTWGLIVMVMIYSLRHISGAHFNPAVTITLAIFRRFSYKQVPLYIFAQLLGSILASGTLALMLDVTPKAYFGTVPVGSNGQSLVAEVIITFLLMFVISAVSTDDKAVGDFAGVAVGMTIMLNVFIAGPVSGASMNPARSIGPALIKHVYQGLWIYVVGPIVGSIAGALAYNFLRSPYKPPSE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo