Glyma14g07320 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma14g07320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma14g07320): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma14g07320

Feature Type:	gene_model
Chromosome:	Gm14
Start:	5486471
stop:	5487638
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma14g07320

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G39705	AT	Annotation by Michelle Graham. TAIR10: ROTUNDIFOLIA like 8 \| chr2:16557038-16557301 FORWARD LENGTH=87	SoyBase	E_val: 4.00E-25	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0016925	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein sumoylation	SoyBase	N/A	ISS
GO:0048367	GO-bp	Annotation by Michelle Graham. GO Biological Process: shoot development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF08137	PFAM	DVL family	JGI		ISS
UniRef100_C6TJR2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJR2_SOYBN	SoyBase	E_val: 6.00E-51	ISS
UniRef100_Q8S8S3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DVL11 n=2 Tax=Arabidopsis RepID=Q8S8S3_ARATH	SoyBase	E_val: 2.00E-22	ISS

Expression Patterns of Glyma14g07320

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma14g07320 not represented in the dataset	Glyma14g07320 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g07320

Paralog	Evidence	Comments
Glyma02g41630	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g07320 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.14g067500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma14g07320

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma14g07320

Limit To All Plant Sequences

>Glyma14g07320.1   sequence type=CDS   gene model=Glyma14g07320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTTCTGTATCCACCACACCACCTTTGTACTTTGATGAGAAGTGGAAGCTGTCAAAGAAAGAAGGATCCACCAGAAGCAGGTCCTCAAGCACCCCTTTCATCAAGAATTCTTCCTCACAGAGAAGGTGTGCTTTTGCTAGCAAGTGTGCGAGGCTTGTAAAGGAGCAAAGGGCGCGTTTCTACATCATGAGGCGGTGTGTGACAATGCTCATATGCTGGCGTGACTACAGTGATTCGTGA

Predicted protein sequences of Glyma14g07320

Limit To All Plant Sequences

>Glyma14g07320.1   sequence type=predicted peptide   gene model=Glyma14g07320   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSVSTTPPLYFDEKWKLSKKEGSTRSRSSSTPFIKNSSSQRRCAFASKCARLVKEQRARFYIMRRCVTMLICWRDYSDS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain