SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G38120 | AT | Annotation by Michelle Graham. TAIR10: Transmembrane amino acid transporter family protein | chr2:15973493-15976792 FORWARD LENGTH=485 | SoyBase | E_val: 0 | ISS |
| GO:0000271 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process | SoyBase | N/A | ISS |
| GO:0001736 | GO-bp | Annotation by Michelle Graham. GO Biological Process: establishment of planar polarity | SoyBase | N/A | ISS |
| GO:0006865 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid transport | SoyBase | N/A | ISS |
| GO:0006949 | GO-bp | Annotation by Michelle Graham. GO Biological Process: syncytium formation | SoyBase | N/A | ISS |
| GO:0007155 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell adhesion | SoyBase | N/A | ISS |
| GO:0007389 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pattern specification process | SoyBase | N/A | ISS |
| GO:0008361 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell size | SoyBase | N/A | ISS |
| GO:0009624 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nematode | SoyBase | N/A | ISS |
| GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth | SoyBase | N/A | ISS |
| GO:0009926 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin polar transport | SoyBase | N/A | ISS |
| GO:0009932 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell tip growth | SoyBase | N/A | ISS |
| GO:0009958 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive gravitropism | SoyBase | N/A | ISS |
| GO:0010015 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root morphogenesis | SoyBase | N/A | ISS |
| GO:0010090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis | SoyBase | N/A | ISS |
| GO:0010218 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to far red light | SoyBase | N/A | ISS |
| GO:0010311 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root formation | SoyBase | N/A | ISS |
| GO:0010817 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels | SoyBase | N/A | ISS |
| GO:0040007 | GO-bp | Annotation by Michelle Graham. GO Biological Process: growth | SoyBase | N/A | ISS |
| GO:0043481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0048765 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0048829 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root cap development | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009986 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell surface | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0010011 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: auxin binding | SoyBase | N/A | ISS |
| GO:0010328 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: auxin influx transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0015171 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity | SoyBase | N/A | ISS |
| KOG1303 | KOG | Amino acid transporters | JGI | ISS | |
| PTHR22950 | Panther | AMINO ACID TRANSPORTER | JGI | ISS | |
| PTHR22950:SF14 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF01490 | PFAM | Transmembrane amino acid transporter protein | JGI | ISS | |
| UniRef100_I1M7V6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M7V6_SOYBN | SoyBase | E_val: 0 | ISS |
| UniRef100_Q9FEL8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Auxin transporter-like protein 1 n=2 Tax=Medicago truncatula RepID=LAX1_MEDTR | SoyBase | E_val: 0 | ISS |
|
Glyma14g06600 not represented in the dataset |
Glyma14g06600 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma02g42290 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g060700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g06600.1 sequence type=CDS gene model=Glyma14g06600 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTACCCCAGAAGCAAGGTGAAGAAACCATGATGTCAAACCTTAACGAAACAACGATTGAGCGTGGTGAAGAGAGAGAGGAAGAGAACGTGGGTGGTGGTTCACATTCCAGTTTGAAAAGCATTCTTTGGCATGGTGGGTCTGCTTATGATGCATGGTTCAGCTGTGCCTCAAATCAGGTTGCGCAGGTTCTGCTAACACTGCCATACTCTTTCTCTCAGCTGGGAATGCTCTCTGGCATCATATTCCAAGTCTTCTATGGAATAATGGGAAGTTGGACAGCTTATCTGATTAGCATTCTGTACATCGAGTACAGGACCAGAAAAGAGAAAGAGAGTGTCAGCTTCAAAAACCATGTCATTCAGTGGTTTGAAGTGTTGGAAGGTTTACTGGGTCCATACTGGAAAGCCATTGGCTTGGCCTTCAATTGCACTTTCCTCCTCTTTGGGTCCGTTATCCAGCTTATTGCTTGTGCAAGCAACATATACCTCATAAATGACCACTTGGATAAGAGGACCTGGACTTACATATTCGGAGCTTGCTGTGCCACCACAGTGTTCGTACCTTCATTTCACAACTACAGAATTTGGTCTTTCCTTGGCCTTGGCATGACCACTTACACAGCTTGGTACATGACCATTGCAGCCATTGCTCATGGCCAGGTTGAAAATGTGACTCACACTGGCCCAAAAAAATTGGTATTGTATTTCACGGGCGCCACCAACATTCTCTACACTTTCGGCGGGCACGCCGTCACAGTGGAAATCATGCATGCAATGTGGAAACCTCAAAAGTTCAAATATATCTATCTTTATGCTACTCTTTATGTGTTCACACTCACCCTACCATCTGCTGTTGCCGTTTATTGGGCCTTTGGTGACAAACTCCTGGACCACTCCAATGCTTTCTCTCTTCTTCCCCGCTCTGGTTGGCGCGATGCCGGTGTCATCTTAATGCTGATTCATCAGTTCATCACTTTTGGATTTGCTTGCACACCATTGTATTTTGTGTGGGAGAAGGTGATAGGAATGCATGACACAAAGAGCATATGTTTGAGGGCACTTGCTAGGTTGCCTGTGGTGATACCAATCTGGTTTTTGGCTATTATCTTCCCTTTCTTTGGTCCTATTAACTCTGCTGTGGGGGCTCTTCTGGTTAGCTTCACCGTGTATGTCATCCCTGCTTGTGCTCATATGCTCACTTACAAGTCTGCTTCTGCACGACAGAATGCTGCTGAGAAATTGCCCTTCTTCATCCCAAACTGGACGGCAATGTATGTGGTGAATGCATTTGTGGTGGTGTGGGTTCTAGTGGTTGGATTTGGATTTGGAGGGTGGGCTAGCATGACAAACTTTATCAAACAGGTTGACACATTTGGACTCTTTGCCAAGTGCTACCAATGCCCGCCAAAAGTCCCTGCTTCCAACAACACAATGCTGCATCATTGA
>Glyma14g06600.1 sequence type=predicted peptide gene model=Glyma14g06600 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLPQKQGEETMMSNLNETTIERGEEREEENVGGGSHSSLKSILWHGGSAYDAWFSCASNQVAQVLLTLPYSFSQLGMLSGIIFQVFYGIMGSWTAYLISILYIEYRTRKEKESVSFKNHVIQWFEVLEGLLGPYWKAIGLAFNCTFLLFGSVIQLIACASNIYLINDHLDKRTWTYIFGACCATTVFVPSFHNYRIWSFLGLGMTTYTAWYMTIAAIAHGQVENVTHTGPKKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLYATLYVFTLTLPSAVAVYWAFGDKLLDHSNAFSLLPRSGWRDAGVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPVVIPIWFLAIIFPFFGPINSAVGALLVSFTVYVIPACAHMLTYKSASARQNAAEKLPFFIPNWTAMYVVNAFVVVWVLVVGFGFGGWASMTNFIKQVDTFGLFAKCYQCPPKVPASNNTMLHH*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
