SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma14g06290

Feature Type:gene_model
Chromosome:Gm14
Start:4536913
stop:4544639
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma14g06290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40220AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr2:16796599-16797585 REVERSE LENGTH=328 SoyBaseE_val: 1.00E-40ISS
GO:0005983GO-bp Annotation by Michelle Graham. GO Biological Process: starch catabolic process SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009747GO-bp Annotation by Michelle Graham. GO Biological Process: hexokinase-dependent signaling SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010353GO-bp Annotation by Michelle Graham. GO Biological Process: response to trehalose stimulus SoyBaseN/AISS
GO:0010449GO-bp Annotation by Michelle Graham. GO Biological Process: root meristem growth SoyBaseN/AISS
GO:0010896GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of triglyceride catabolic process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0031930GO-bp Annotation by Michelle Graham. GO Biological Process: mitochondria-nucleus signaling pathway SoyBaseN/AISS
GO:0032880GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein localization SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
GO:0044212GO-mf Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region DNA binding SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_B9P4N2UniRef Annotation by Michelle Graham. Most informative UniRef hit: SGR n=1 Tax=Glycine max RepID=B9P4N2_SOYBN SoyBaseE_val: 2.00E-109ISS
UniRef100_I1M7R9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M7R9_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma14g06290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma14g06290
ParalogEvidenceComments
Glyma02g43240 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma14g06290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.14g057900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma14g06290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma14g06290
>Glyma14g06290.1   sequence type=CDS   gene model=Glyma14g06290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAACCAAACCACGGCACACACACTGAAACCACTCCCAGCGAAACATCTACAGTACACAACAACGACAAAATCAGTAGTCGTAAGTGCAAAGGTAAAGGTGGCCCCGACAACAACAAATTTAGGTACCGCGGCGTCAGACAACGAAGCTGGGGCAAATGGGTCGCCGAGATCCGCGAGCCACGCAAGCGAACTCGTAAGTGGCTTGGAACCTTCGCCACCGCCGAGGACGCCGCCAGAGCCTACGACCGCGCCGCCATCATCCTCTACGGTTCCAGGGCACAGCTTAACCTCCAACCCTCCGGTTCCTCTTCTCAATCTTCCTCTTCTCGCTCCTCTTCCTCTTCCACCCAAACCCTAAGACCCTTGCTTCCTCGCCCTTCAGGTTTTTCTGTCAATTTTCCATTTAACACCGCTACCGTGCCTTACCCTTATAACAATAGTCACAATTACACTTACTCCCCACCGGTTCTGTGCCCTAATGATAATCACAATAATAATATAGTGCAAGTTCATCATCCTCATCACCATCGTTGTCCCGAGGAATTGGTGCAAGTGCAAGTGGCACATACTCTATCAACATCGTACCAACATAATTCGGAATCCGATGTGGGTTTAGGTGTGAATAATAATGTTTTTGTTGTTGATGGTTCTATTAGATCAACCTCGTACCAAAGGCATGGTTTTCTGGATAGTAATAATAATCATGTGCATGTGCAAGTGCAACATGGGGTTTTGTCGAATCAACAGCAACAGCAACATCAGAATGGCGTGGTGGTGGAGGGAGTGAATAATTCCCCCGTTGTGGGTTCGGTTGCGTCTGCTATGGATGCTTCTTCGGTGGATCCGGATCTGGCGTTGGTGGGGACAGTGGGGCTTGGATCTTCTTCGCCGTTTTGGTCCATGGCGAACGAGGATGACTACACTGTGCAAATACATTTTGCTGCTGGTGATTGGGAAGCAAATCAACGATGA
Predicted protein sequences of Glyma14g06290
>Glyma14g06290.1   sequence type=predicted peptide   gene model=Glyma14g06290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KPNHGTHTETTPSETSTVHNNDKISSRKCKGKGGPDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQLNLQPSGSSSQSSSSRSSSSSTQTLRPLLPRPSGFSVNFPFNTATVPYPYNNSHNYTYSPPVLCPNDNHNNNIVQVHHPHHHRCPEELVQVQVAHTLSTSYQHNSESDVGLGVNNNVFVVDGSIRSTSYQRHGFLDSNNNHVHVQVQHGVLSNQQQQQHQNGVVVEGVNNSPVVGSVASAMDASSVDPDLALVGTVGLGSSSPFWSMANEDDYTVQIHFAAGDWEANQR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo