SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G40220 | AT | Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr2:16796599-16797585 REVERSE LENGTH=328 | SoyBase | E_val: 1.00E-40 | ISS |
| GO:0005983 | GO-bp | Annotation by Michelle Graham. GO Biological Process: starch catabolic process | SoyBase | N/A | ISS |
| GO:0006355 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0006970 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to osmotic stress | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009640 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photomorphogenesis | SoyBase | N/A | ISS |
| GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
| GO:0009747 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hexokinase-dependent signaling | SoyBase | N/A | ISS |
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS |
| GO:0009793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy | SoyBase | N/A | ISS |
| GO:0009845 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed germination | SoyBase | N/A | ISS |
| GO:0009909 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of flower development | SoyBase | N/A | ISS |
| GO:0009933 | GO-bp | Annotation by Michelle Graham. GO Biological Process: meristem structural organization | SoyBase | N/A | ISS |
| GO:0010162 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed dormancy process | SoyBase | N/A | ISS |
| GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0010228 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem | SoyBase | N/A | ISS |
| GO:0010353 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to trehalose stimulus | SoyBase | N/A | ISS |
| GO:0010449 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root meristem growth | SoyBase | N/A | ISS |
| GO:0010896 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of triglyceride catabolic process | SoyBase | N/A | ISS |
| GO:0016567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein ubiquitination | SoyBase | N/A | ISS |
| GO:0019915 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipid storage | SoyBase | N/A | ISS |
| GO:0031930 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mitochondria-nucleus signaling pathway | SoyBase | N/A | ISS |
| GO:0032880 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of protein localization | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0048316 | GO-bp | Annotation by Michelle Graham. GO Biological Process: seed development | SoyBase | N/A | ISS |
| GO:0048527 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root development | SoyBase | N/A | ISS |
| GO:0050826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to freezing | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0003677 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA binding | SoyBase | N/A | ISS |
| GO:0003700 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity | SoyBase | N/A | ISS |
| GO:0043565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding | SoyBase | N/A | ISS |
| GO:0044212 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transcription regulatory region DNA binding | SoyBase | N/A | ISS |
| PF00847 | PFAM | AP2 domain | JGI | ISS | |
| UniRef100_B9P4N2 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: SGR n=1 Tax=Glycine max RepID=B9P4N2_SOYBN | SoyBase | E_val: 2.00E-109 | ISS |
| UniRef100_I1M7R9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1M7R9_SOYBN | SoyBase | E_val: 0 | ISS |
|
Glyma14g06290 not represented in the dataset |
Glyma14g06290 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma02g43240 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.14g057900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma14g06290.1 sequence type=CDS gene model=Glyma14g06290 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AAACCAAACCACGGCACACACACTGAAACCACTCCCAGCGAAACATCTACAGTACACAACAACGACAAAATCAGTAGTCGTAAGTGCAAAGGTAAAGGTGGCCCCGACAACAACAAATTTAGGTACCGCGGCGTCAGACAACGAAGCTGGGGCAAATGGGTCGCCGAGATCCGCGAGCCACGCAAGCGAACTCGTAAGTGGCTTGGAACCTTCGCCACCGCCGAGGACGCCGCCAGAGCCTACGACCGCGCCGCCATCATCCTCTACGGTTCCAGGGCACAGCTTAACCTCCAACCCTCCGGTTCCTCTTCTCAATCTTCCTCTTCTCGCTCCTCTTCCTCTTCCACCCAAACCCTAAGACCCTTGCTTCCTCGCCCTTCAGGTTTTTCTGTCAATTTTCCATTTAACACCGCTACCGTGCCTTACCCTTATAACAATAGTCACAATTACACTTACTCCCCACCGGTTCTGTGCCCTAATGATAATCACAATAATAATATAGTGCAAGTTCATCATCCTCATCACCATCGTTGTCCCGAGGAATTGGTGCAAGTGCAAGTGGCACATACTCTATCAACATCGTACCAACATAATTCGGAATCCGATGTGGGTTTAGGTGTGAATAATAATGTTTTTGTTGTTGATGGTTCTATTAGATCAACCTCGTACCAAAGGCATGGTTTTCTGGATAGTAATAATAATCATGTGCATGTGCAAGTGCAACATGGGGTTTTGTCGAATCAACAGCAACAGCAACATCAGAATGGCGTGGTGGTGGAGGGAGTGAATAATTCCCCCGTTGTGGGTTCGGTTGCGTCTGCTATGGATGCTTCTTCGGTGGATCCGGATCTGGCGTTGGTGGGGACAGTGGGGCTTGGATCTTCTTCGCCGTTTTGGTCCATGGCGAACGAGGATGACTACACTGTGCAAATACATTTTGCTGCTGGTGATTGGGAAGCAAATCAACGATGA
>Glyma14g06290.1 sequence type=predicted peptide gene model=Glyma14g06290 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high KPNHGTHTETTPSETSTVHNNDKISSRKCKGKGGPDNNKFRYRGVRQRSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAIILYGSRAQLNLQPSGSSSQSSSSRSSSSSTQTLRPLLPRPSGFSVNFPFNTATVPYPYNNSHNYTYSPPVLCPNDNHNNNIVQVHHPHHHRCPEELVQVQVAHTLSTSYQHNSESDVGLGVNNNVFVVDGSIRSTSYQRHGFLDSNNNHVHVQVQHGVLSNQQQQQHQNGVVVEGVNNSPVVGSVASAMDASSVDPDLALVGTVGLGSSSPFWSMANEDDYTVQIHFAAGDWEANQR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
